KEGG   Alcaligenes aquatilis: D3M96_12835Help
Entry
D3M96_12835       CDS       T05678                                 

Definition
(GenBank) prephenate dehydratase
  KO
K14170  chorismate mutase / prephenate dehydratase [EC:5.4.99.5 4.2.1.51]
Organism
aaqu  Alcaligenes aquatilis
Pathway
aaqu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aaqu01100  Metabolic pathways
aaqu01110  Biosynthesis of secondary metabolites
aaqu01130  Biosynthesis of antibiotics
aaqu01230  Biosynthesis of amino acids
Module
aaqu_M00024  Phenylalanine biosynthesis, chorismate => phenylalanine
aaqu_M00025  Tyrosine biosynthesis, chorismate => tyrosine
Brite
KEGG Orthology (KO) [BR:aaqu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    D3M96_12835
Enzymes [BR:aaqu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     D3M96_12835
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     D3M96_12835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT CM_2 ACT HTH_AsnC-type HrpE
Motif
Other DBs
NCBI-ProteinID: AYN21333
UniProt: A0A3G2HWA3
LinkDB All DBs
Position
complement(2818996..2820087)
Genome map
AA seq 363 aa AA seqDB search
MANTLTERLLPWRNRIDELDRQILELLNERARAALEVGKIKQDFNTEEVILKPEREARIV
RRLQSENDGPFTPAAVEAVWGQIISACRGLESVLRVAYLGPQGSFSEQAAYEHFGHALDG
LQCDSFDEVFRSVEVGQAEVGMVPVENSTEGAVNRTLDLLLNSPLRVLGERSIRVHHNLL
TQTGTMEGVTRVMAHPQALAQCQNWLQKHYPQLLREAASSNAEAARIAASDPTVAAIAGN
TAVTAWNLGVVEAGIQDDPHNRTRFLAIGNIESLPSGNDKTSIILAVPNRAGAVYDMLSP
LAVHGVSMTRLESRPARTGQWEYYFYVDLIGHRDEPAMAAALAELKKQVAFFKILGSYPV
NDF
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggctaataccttaactgagcgcctgctcccttggcgcaatcgtattgatgagctggat
cgccagatcctggagttgctcaacgagcgtgctcgtgcggctttggaagtgggcaagatc
aagcaggacttcaatacagaggaagtcatcctcaagcccgagcgcgaggcacgtattgtg
cgtcgcttgcagtctgaaaatgatggcccgtttactcctgccgcagtggaagccgtgtgg
gggcagattatttctgcctgccgcggtctggaaagcgtattgcgcgtggcttacctgggt
ccacaaggctcgttttccgagcaagccgcttacgaacattttggtcatgctctggatggc
ctgcagtgtgactccttcgatgaggtttttcgcagcgtcgaggtggggcaagcagaagtg
ggtatggtgcccgtcgagaactcgaccgaaggtgcggttaaccgcaccttggatcttttg
ctgaactcgcccttgcgtgtcctgggcgagcgctcgattcgtgtacaccacaatctgctg
acccagaccggcaccatggaaggcgtcactcgggtgatggctcatccgcaggccttggcg
cagtgtcagaactggctgcaaaagcactacccccagcttttgcgtgaagccgcttccagc
aatgcggaggccgctcgcattgcggcttccgaccccaccgtggcggcgattgccggtaat
accgctgtcactgcctggaatctgggcgtggtggaagccggtatccaggacgatccgcat
aaccgcacacgtttcctggcgatcggtaacatcgagtccttgcctagcggcaacgacaag
accagcatcattctggccgtgcccaaccgggctggcgctgtctatgacatgctgtctccg
ttggcggtacatggcgtttccatgactcgtctggagtcgcgtcctgcacggacagggcag
tgggaatattatttctacgtagacctgatcggccatcgtgacgagcctgccatggcagcg
gccttggctgaattgaagaaacaagtcgcttttttcaagattctgggttcttaccccgta
aacgacttttaa

DBGET integrated database retrieval system