KEGG   Alcaligenes aquatilis: D3M96_15650Help
Entry
D3M96_15650       CDS       T05678                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
aaqu  Alcaligenes aquatilis
Brite
KEGG Orthology (KO) [BR:aaqu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    D3M96_15650
Enzymes [BR:aaqu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     D3M96_15650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like DAO FAD_oxidored FAD_binding_2 Thi4 Glutaredoxin K_oxygenase FAD_binding_3 NAD_binding_8 Thioredoxin_4 NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AYN21832
UniProt: A0A3G2HXE3
LinkDB All DBs
Position
complement(3402673..3404265)
Genome map
AA seq 530 aa AA seqDB search
MLDANIKTQLKAYLEKITQPIEIVATLDTGAKSVELRELLQEIDGLSDKTSYREDADAQE
RKPSFQINRPGTDISVSFAGIPMGHEFTSLILALLQVGGHEIKLDAAVIEQIRNLPGDFV
FETYFSLSCQNCPDVVQALNAMSVINPRIKHVAIDGALFQDEVQQRNIMSVPAVFLNGEM
FHQGRASVEELLAKLDTGDNSARAEALNAKDEFDVLIVGGGPAGAAAAVYAARKGIRTGV
LAERFGGQVLDTMSIENYISVVETNGPAFATALEQHVKTYDVDIMNLHRAKGIRREGKKV
IVDVDGGAQLKAKSVILATGARWRELNVPGEQDYRNRGVAYCPHCDGPLFKGKDVAVVGG
GNSGVEAAIDLAGLVKHVTLIEFGDALRADQVLQNKLRSMPNVTIITQAQTTEVLGDGAK
VVGLNYLDRQTQEAKSIKLDGVFVQIGLVPNTEWLKGSDVALSRHGEIEVDVRGATSLTG
VFAAGDVTTVPYKQIVIAAGEGAKAALSAFDYLIRSSAEVEEPAAEQVTA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcaaacatcaaaactcaattgaaggcatatctcgagaagatcacgcaaccg
atcgagatcgttgcgacgctggatactggcgccaagtccgtcgagctgcgcgaactgttg
caagaaattgatggtctgtccgacaagaccagctatcgcgaagatgcggatgcgcaagag
cgtaagccttccttccaaattaaccgtcccggtaccgacattagcgtgagctttgcgggt
atcccgatgggacacgaatttacctctttgatcctggccctgctgcaagtgggtggccat
gagatcaagctggatgccgctgtgattgagcagatccgtaatctgcccggcgactttgtt
tttgaaacgtatttctcgctgtcgtgccagaactgtcctgacgtggtgcaggccttgaac
gccatgtccgtgatcaacccacgtatcaagcacgtggccattgacggtgccctgttccag
gacgaggttcagcagcgcaacatcatgtcggttccggccgtgttcttgaatggcgaaatg
ttccatcaaggccgtgccagtgttgaagagttgctggccaagctggatacgggcgataac
tcggctcgtgctgaagccctgaatgccaaggacgagtttgatgtcctgatcgtcggcggt
ggtcctgctggtgcagccgcggctgtgtacgctgctcgcaagggtattcgcacgggtgta
ttggccgagcgtttcggtggtcaggttctggacaccatgtctatcgagaactacatctcg
gtggtcgagaccaatggtcctgcctttgccaccgcgctggagcaacacgttaaaacgtac
gatgtggacatcatgaatctgcatcgtgccaagggtattcgccgcgaaggcaagaaagtc
atcgtagatgtggatggcggcgctcaactgaaagccaagtccgtgattctggctaccggt
gcccgctggcgtgaattgaatgtgcctggcgaacaggattaccgtaaccgtggtgtggcg
tactgcccgcactgtgatggtccgctgttcaagggcaaggatgtagcggtggtcggtggt
ggtaactccggtgtcgaggcggcgattgacctggctgggttggtcaagcacgttaccttg
attgagtttggcgatgccttgcgcgctgaccaggttttgcagaacaagctgcgcagcatg
cctaatgtgacgatcattactcaggctcagacgacggaagttctgggtgacggcgccaag
gttgttggtttgaattacctggatcgtcagactcaggaagccaagagcatcaagctggac
ggtgtgtttgttcagattggtctggtgcccaacacggaatggctcaagggcagcgatgtg
gctttgtcgcgtcatggcgagatcgaggttgatgtacgcggcgctacttcgctgacaggt
gtatttgctgcaggcgacgtgacgactgtgccttacaagcagatcgtgattgctgccggt
gagggtgccaaggctgccttgagcgcgtttgattacctgatccgtagttcggctgaagtt
gaagaaccggctgcggagcaagtgactgcttaa

DBGET integrated database retrieval system