KEGG   Alcaligenes aquatilis: D3M96_16805Help
Entry
D3M96_16805       CDS       T05678                                 

Definition
(GenBank) RNB domain-containing ribonuclease
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
aaqu  Alcaligenes aquatilis
Brite
KEGG Orthology (KO) [BR:aaqu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aaqu03016]
    D3M96_16805
Enzymes [BR:aaqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     D3M96_16805
Transfer RNA biogenesis [BR:aaqu03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    D3M96_16805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB UPF0158
Motif
Other DBs
NCBI-ProteinID: AYN22046
UniProt: A0A3G2HY03
LinkDB All DBs
Position
3662083..3663972
Genome map
AA seq 629 aa AA seqDB search
MYVLFEDSGNFKAEKIFSDSDTTMQVESASGKRSKIKKNSVLFTFEQPGPAELLEKAQAL
AESLDINFLWECAPQDEFEASTLAQEYFGHAPNAIEKTGTLFALHSAPAYFHRRGKGLYR
PAPPEILQAALAAIEKKRLQQEQIQTWAEQMIKGELPPEIAQKASTFLTQPDKNTLEWKA
FDQAQKELGVSTEKLLLSLGAWSNPLTLHQHRFLAAHFPKGTGFPHISLQDWGQDLPEAN
VTAYSVDDANTIEIDDALSVQHPEPGRLRVGVHIAVPSLAMTRGNEIDQIARNRMATVYT
PGHKIPMLPPELIARFSLDQGQTRPTLSLYVDADISTGEILSHQTRLERITVAGNLRQHE
LDPLISEAALADENAELPYEQWLRPLWNFSRQLSAQREAVRGKPENNNRVEYSFELDGPH
DDPNSIIRLVPRVRNAPLSLLIAEYMILANQLWGGLLAEHNVPGIYRSQQFMRTRMSTTP
GPHESIGVPQYIWSTSPLRRYVDLINQGQILAAAEHGISARLAAPFQPKDADLYAIIGAF
ESQYTQWSDYQSSLERFWCLRWLQQNDIKQVQASFIKEDLVRLTNAPLVLHVPGLPTLER
GQEVTLDLLSFDELALTVEARLRSVATAD
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgtacgtcctttttgaagacagcggtaatttcaaagcagaaaaaatcttttctgacagc
gataccaccatgcaggtggaatccgcgtctggcaaacgcagcaaaatcaagaaaaacagc
gttctatttaccttcgagcagcccggcccggcagaactgctggaaaaagcccaggcactg
gccgaatccctggatatcaactttttgtgggaatgcgcccctcaggacgaatttgaggcc
tccacgctggcacaggagtattttggccacgcacccaacgctatcgaaaagaccggcacc
ctctttgccttacatagtgcgcccgcctacttccaccgtcgtggcaagggactgtatcgc
cccgcccctccggaaatcttgcaagctgccctggctgccattgagaaaaagcgcctacag
caagagcaaattcagacctgggccgaacagatgatcaagggcgaactgccgcctgaaatc
gctcagaaggccagcaccttcctgacccagccagacaagaacacactggaatggaaagcc
tttgaccaggcccagaaagaattgggtgtcagcacggaaaagctgctgctatcgctgggt
gcctggtccaatccgctgaccttgcatcaacatcgctttctggccgcgcatttccccaaa
ggcacgggctttccccatatttccctacaagactggggacaggatctgcccgaggccaat
gtcaccgcttattcggtggacgacgccaatacgattgaaattgacgatgccctgtctgtc
cagcatccagaaccggggcgcctgcgtgtcggggttcacatcgctgtgccttcactggcc
atgacacgcggcaacgagatcgaccaaattgcccgcaatcgcatggctacggtgtacacg
ccaggccataagattcccatgctgccgcccgaactgatcgcgcgtttctcgctggatcaa
ggccaaactcgccctaccctgtcgctgtatgtagacgcggatatcagcaccggcgaaatc
ctgtcacatcaaacccgtctggaacgcattactgtggcgggcaacttgcgtcagcatgaa
ctggacccactgatcagcgaagcagccctggccgacgaaaacgccgagctgccttacgaa
caatggctgcgccccctgtggaacttctcacgccaattatcggctcagcgtgaagcggta
aggggcaagccagaaaacaataaccgggtcgagtacagcttcgagctggatggcccgcac
gacgatcccaactccatcattcgcctggtgcctcgtgtgcgcaatgcgccgctaagcctg
ttgattgctgaatacatgattctggccaatcagttgtggggcggcttgctggccgagcac
aatgtacctggcatctatcgctcccagcagttcatgcgtacccgcatgtccaccacgccc
ggcccgcacgaatccattggtgtgccgcaatacatctggtccacctcgcccctgcgccgt
tatgtggacctgatcaaccagggccagattctggcggctgccgagcacgggatctctgca
cgtctggcggccccctttcagcccaaagatgcggatttgtacgccatcattggggccttt
gaatcgcaatacacccagtggtcggactaccagtcttctctggagcgcttctggtgcctg
cgctggctgcaacaaaacgacatcaaacaggtccaggccagcttcatcaaggaagatctg
gtgcgcctgaccaatgcgccactcgtgcttcacgtacctggcctgcccacgctggaacgt
ggccaggaagtcacgctggatctgttgtctttcgacgaactggctttgacggtagaagcc
cgcttgcgctcggtcgccacggcggactga

DBGET integrated database retrieval system