KEGG   Alcaligenes aquatilis: D3M96_17025Help
Entry
D3M96_17025       CDS       T05678                                 

Gene name
gatA
Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
aaqu  Alcaligenes aquatilis
Pathway
aaqu00970  Aminoacyl-tRNA biosynthesis
aaqu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aaqu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    D3M96_17025 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:aaqu03029]
    D3M96_17025 (gatA)
Enzymes [BR:aaqu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     D3M96_17025 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     D3M96_17025 (gatA)
Mitochondrial biogenesis [BR:aaqu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    D3M96_17025 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AYN22087
UniProt: A0A3G2HYE0
LinkDB All DBs
Position
3705248..3706768
Genome map
AA seq 506 aa AA seqDB search
MSFTPEFATIAALRLALQNKTVSARELAQQALDNSARQKELNAFVQQDAALTLAQADAAD
ALIAQGKAGPLTGIPIAHKDLFVTKDWQTTACSKMLEGYVSPFDATVVTKLQAAGAVSLG
KLNCDEFAMGSRNESSVFGPVRNPWDHTMVPGGSSGGSAAAVAAGLVAGASATDTGGSIR
QPAALCGVSGIKPTYGTISRFGIIAYGSSLDQAGPIARNARDLLDLLETMCGFDPQDATS
LEFCDDQPNNGARIRQQFEQQQAQQEAQGSQPLKGLRIGVPAQFFGPGLDPVVADAIEAA
LKTYESLGAERVTVQLPLTELSVPTYYVISPAEASTNLSRFDGVRFGHRASQYTDLNSMI
SRSRSEGFGPEVVRRILVGTYVLSHGYYDAYYLQAQRVRRMIVDDFQKAFEQCDLILGPV
TPALGRKLGATIEDPTTDWLGDVYTLGVSLAGLPAMSIPCGLSNDERPLPIGLQIIGNYF
REGQLLAFADRFQQVTDWHQRQPGQQ
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttacccctgaattcgcgactattgcagcgctgcgactagctctgcaaaacaaa
accgtcagtgcccgcgagctggcccagcaagccctggacaacagcgcccgtcaaaaagag
ctcaatgcctttgttcagcaagacgccgccctgaccctggcacaggccgatgccgccgat
gccctgattgcccaaggcaaggccggtccactgaccggcatcccgatcgcccacaaagat
ttgtttgtcaccaaggattggcagaccaccgcctgcagcaaaatgctggaaggctatgtc
agcccctttgacgctacggtggtgaccaagctgcaggcagccggtgctgtctcgctgggc
aaactgaactgtgacgagttcgccatgggatcgcgcaacgaaagctcggtattcggtccc
gtacgtaacccctgggatcacaccatggtgcctggtggttcgtcaggtggttccgccgct
gcggtggccgctggcctagtagccggtgcaagcgcaaccgataccggcggctcgattcgc
caacctgccgccctgtgcggtgtcagcggcatcaagcccacctacggcacgatttcccgc
tttggcatcattgcttacggctccagcctggatcaggccggccctatcgcccgtaatgcc
cgcgacttgctcgatctgctggaaaccatgtgcggtttcgacccccaagatgctaccagc
ctggaattttgtgacgatcagcccaataacggcgcgcgtattcgtcagcaatttgaacag
caacaggctcaacaagaagcccaaggcagtcagccactgaaaggcctgcgtattggtgtg
cccgcccagttctttggccccggcctggacccggtcgttgccgacgccatcgaagccgcc
ctgaaaacctacgaaagcctgggtgcagaacgcgtcaccgtgcaactgcccctgaccgag
ctgtctgtccctacgtattacgtcatcagccccgctgaggcctcaaccaacctgtcacgc
tttgacggtgtacgctttggccaccgcgccagccagtacaccgacctgaacagcatgatc
tcgcgttcgcgctcggaaggttttggccctgaggtggtgcgccgcattctggttggcact
tacgtgctctcgcacggctactacgacgcctactatctgcaagcccaacgcgtacgccgc
atgattgtggacgacttccaaaaagcctttgaacagtgcgacctgatccttggccccgtc
acaccggccctgggccgcaagctgggtgccaccatcgaggaccccactaccgactggctg
ggcgatgtctacacgctgggcgtcagtctggctggcctgcccgccatgtccattccttgc
ggcctcagtaacgatgagcgccccttgcccatcggcctgcaaatcattggcaactacttc
cgtgaaggccaattgctggcctttgccgaccgcttccagcaagtcaccgactggcatcaa
cgtcaaccaggacaacaataa

DBGET integrated database retrieval system