KEGG   Alcaligenes aquatilis: D3M96_17950Help
Entry
D3M96_17950       CDS       T05678                                 

Definition
(GenBank) superoxide dismutase [Cu-Zn] SodC2
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
aaqu  Alcaligenes aquatilis
Brite
Enzymes [BR:aaqu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     D3M96_17950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AYN22263
LinkDB All DBs
Position
3916883..3917431
Genome map
AA seq 182 aa AA seqDB search
MRFSSFKARCAMALATVSATLALSAPSLADVIIPMNLATESGAGEQIGQVSVRQTEHGLV
FTPDLKNLKPGVHGFHIHENASCAPSEKDGKVTPAGAAGGHLDPNKTGKHGFPWGNGHLG
DLPALYVQADGSASTPVLAPRLKSLDQIKGRALMIHEGGDNHSDHPAPLGGGAGRFACGV
IK
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttttcttccttcaaagcgcgatgcgcaatggccttggccaccgtcagcgccacc
cttgccttgtcggcaccttcactggcggacgtcattattcccatgaatctggctaccgaa
agcggtgctggcgagcaaatcggccaggtcagcgttcggcagactgaacacggtctggtt
ttcacgccagatctgaaaaatctcaaacccggtgtacatggtttccatatacatgagaac
gccagctgcgcgcccagcgagaaagacggaaaggtaacgcctgccggggcagccggtggc
catctggaccctaacaagaccggcaagcacggtttcccatggggcaatggacacctgggg
gatttgcccgccctgtatgtccaggccgacggcagtgccagcactcccgttctggctccg
cgcctgaagtccctggatcagatcaagggccgagccctgatgatccacgaaggcggtgac
aaccactccgatcaccctgcaccactgggcggcggtgccggacgctttgcttgcggagtg
atcaagtaa

DBGET integrated database retrieval system