KEGG   Acetohalobium arabaticum: Acear_0036Help
Entry
Acear_0036        CDS       T01290                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, alpha subunit
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
aar  Acetohalobium arabaticum
Pathway
aar00010  Glycolysis / Gluconeogenesis
aar00020  Citrate cycle (TCA cycle)
aar00620  Pyruvate metabolism
aar00633  Nitrotoluene degradation
aar00640  Propanoate metabolism
aar00650  Butanoate metabolism
aar00680  Methane metabolism
aar00720  Carbon fixation pathways in prokaryotes
aar01100  Metabolic pathways
aar01120  Microbial metabolism in diverse environments
aar01130  Biosynthesis of antibiotics
aar01200  Carbon metabolism
Module
aar_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aar00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acear_0036
   00020 Citrate cycle (TCA cycle)
    Acear_0036
   00620 Pyruvate metabolism
    Acear_0036
   00640 Propanoate metabolism
    Acear_0036
   00650 Butanoate metabolism
    Acear_0036
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Acear_0036
   00680 Methane metabolism
    Acear_0036
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Acear_0036
Enzymes [BR:aar01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Acear_0036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: ADL11588
UniProt: D9QSQ0
LinkDB All DBs
Position
37906..39087
Genome map
AA seq 393 aa AA seqDB search
MSNEVALTGHEVIANAMRQINPDVVAAYPITPQTEIVQLFSQFVADGKVDTDFVTVESEH
SAMSATVGASAGGARAMTATAANGLALMWEIVYIAASTRLPIVMPVVNRALSGPINIHCD
HSDAMGARDSGWIQLYAEDAQEAYDNAVQAVRIGEHEDVRLPVMVNMDGFIISHAVENME
LLADEDVQEFVGEYEPENTLLDSENPITVGPIDLQDFYFEHKRQQVDAMENAKDVIADIA
QEYKEMTGRGVEYFEEYKLDDAEIGILALGSTAGTAKVAVDDLREQGVKAGLLKLRMFRP
FPTEELVEALKDLEVLAVMDRADTFSTTGGPVFADVRSAFYDAKADVEVVNYIYGLGGRD
TRVEDIESIYEDLQEIAASGKVENRVNYLGVRE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacgaggttgctttaactggtcacgaagtaatagctaatgccatgaggcagata
aatcctgatgttgtagcagcatatccaataactccgcagacagaaattgtacagttattt
tcacaatttgttgcggatggaaaagtagatacagattttgttactgtagagagtgaacac
agtgcaatgagtgctacagtcggtgcatctgctggtggagctagagcaatgactgctact
gctgctaatggtttagctttaatgtgggaaattgtatatattgctgcatcaactagattg
ccgattgtaatgcctgtagtaaatagagcattaagtggaccaattaatattcactgtgat
cacagtgatgctatgggggctagagattccggctggattcagctatatgctgaggatgcc
caggaagcttatgataatgctgttcaggctgtaagaattggtgaacatgaagatgttaga
ctacctgttatggttaatatggacgggtttattatcagtcatgcagtagagaatatggaa
ttattagctgacgaagacgtacaggaatttgttggtgaatatgaaccggaaaatacttta
ttagattctgaaaatccaattactgtaggaccgattgacctacaggacttctatttcgag
cataaacgtcagcaggttgatgcaatggagaatgctaaagatgttattgctgatattgct
caagaatataaagaaatgacaggtcgcggcgttgaatattttgaagagtataagttagat
gatgcagaaattggaattttagctttaggttctactgctggaactgctaaagtagctgtt
gatgacttaagagagcagggggttaaggctggacttctcaaattaagaatgtttagacct
ttcccaacagaagagcttgtagaagcacttaaagatttagaagtattagctgtaatggat
agagcagataccttctctactactggaggacctgtatttgctgatgtaagaagtgctttc
tatgatgctaaagctgatgtagaggtagttaactatatctatggtttaggtggtcgtgat
actagagttgaagatatagaatctatttatgaagatctacaggaaattgctgcttctggt
aaggttgaaaatagagtaaattatctcggtgtaagagaatag

DBGET integrated database retrieval system