KEGG   Acetohalobium arabaticum: Acear_0360
Entry
Acear_0360        CDS       T01290                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
aar  Acetohalobium arabaticum
Pathway
aar00300  Lysine biosynthesis
aar01100  Metabolic pathways
aar01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aar00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Acear_0360
Enzymes [BR:aar01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     Acear_0360
SSDB
Motif
Pfam: 2-Hacid_dh_C TrkA_N OCD_Mu_crystall NAD_binding_7 Shikimate_DH NAD_binding_2 adh_short Gp_dh_N AdoHcyase_NAD AlaDh_PNT_C 3HCDH_N 3Beta_HSD UDPG_MGDP_dh_C
Other DBs
NCBI-ProteinID: ADL11907
UniProt: D9QUB4
LinkDB
Position
392930..393736
AA seq 268 aa
MTRLFTDQISHIPETIDEYNQELKDKTGCGLVGLANHALGTEYETAFLAQKRAAVVPVTV
GEGIIQGFSKSVAAILEYMGFEILVTNSSDVKGIKEAYQKKADILLMADDDEFIALNLEE
NKYVDNNWATARAYVNALELMVGGLKDRTVVVQGLGPIGREAVRALIEKEARIKVYDVDE
QKMIKLTEEVESVEAVKNPEQELKHNKLILEATPVDNTIQEDYIDQKTYISAPGVPLGVC
KTAISSIEDRLIHDPLQLGVSLMAAGVL
NT seq 807 nt   +upstreamnt  +downstreamnt
atgactagattatttactgatcagataagccatattccagagacaatagacgaatataac
caggaattgaaggataagaccgggtgtgggctagtaggcttggccaatcatgctttagga
actgagtatgaaactgcttttttggctcaaaagagagctgctgttgtccctgttaccgta
ggtgaagggattattcagggattcagtaaatcagtagcagctattttagaatatatgggg
tttgagattttggttaccaatagttcagatgtaaaaggaattaaagaagcatatcaaaag
aaagcagatattcttttgatggccgatgatgatgaatttatagctttgaatctggaagag
aataaatatgttgataataactgggctacagcaagggcttatgtgaatgctttggaatta
atggtaggcggattgaaagatagaacagtagttgtacagggattaggcccaatagggaga
gaggctgttagagccttaatagagaaggaagcccggataaaggtctatgatgttgatgag
cagaagatgataaaattaacagaggaggttgaatctgtagaggctgtaaagaatccggaa
caagaattaaaacataataaattaattctagaagcaactcctgttgataatactatacaa
gaggattatatcgatcaaaaaacatatatttctgctcctggagttcccttaggtgtctgc
aaaactgctataagtagtattgaagatagattaattcatgatccgttacagttgggagta
agcttgatggcggctggggttttatag

DBGET integrated database retrieval system