KEGG   Acetohalobium arabaticum: Acear_0579Help
Entry
Acear_0579        CDS       T01290                                 

Definition
(GenBank) cell envelope-related transcriptional attenuator
  KO
K01005  polyisoprenyl-teichoic acid--peptidoglycan teichoic acid transferase [EC:2.7.8.-]
Organism
aar  Acetohalobium arabaticum
Brite
KEGG Orthology (KO) [BR:aar00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Acear_0579
Enzymes [BR:aar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.-  
     Acear_0579
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LytR_cpsA_psr LytR_C ETRAMP DUF3357
Motif
Other DBs
NCBI-ProteinID: ADL12122
UniProt: D9QV63
LinkDB All DBs
Position
627169..628419
Genome map
AA seq 416 aa AA seqDB search
MAKYNKYERHRLKKKQEKEKKRSKKRFIYKLIALLVLLIIIASAGVFMKGWQLDNDDNDL
QSAVDTEREQINCLILGSDALDDGTTRTDVVILASFDLKSRKLGLFSLPRDTRVEIPGRD
GYHKLNAAYAYGGPKLVTKTVEDLLKVPIDHYISTDFNGFREIIDTLDGVKVNVEKHLKY
IDQAGGLYIDIPAGRQTLSGQKALEYIRFRHDKLGDIGRIERQHKFLEALLERVYNPKVL
LKTPKLLSHIRNNVETDLPWLESLQAAPELIKLITDLDQNKVGMATLPGEPEYIDGISYW
IPDQLLVDRVVDSLINTKEYIPNSKLNISILNGNGKQGAAYQLETLLSSSGYNIVQTANA
DTFNYVQTCIYFNPNVSDKAQELAGYLKGRLIEWEDVDTKKEVDIKIILGENSNIS
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaatataataaatatgagcggcaccggctgaaaaagaaacaggagaaagaaaag
aaacggtctaaaaaacgatttatctataagctcattgctttactggtattattgattatt
attgctagcgctggtgtctttatgaagggttggcagctggataatgatgataatgatcta
cagtcggctgtagatactgaacgagaacagataaactgtcttatattaggatctgatgct
ttagatgatgggacaaccagaactgatgttgtaattcttgccagttttgatttaaaaagc
agaaaattaggtcttttttctctgccgcgggataccagagtggagattccgggaagggat
ggataccataaattaaatgctgcttatgcctatggaggtcctaagttagttactaaaaca
gtagaggacttattaaaagtaccaattgatcactatataagtactgactttaatggtttt
cgggaaataatcgataccttagatggggttaaagttaatgtagaaaagcatttaaaatat
attgatcaggctggtggcttatatatcgatattccggctggtagacagactttatctggc
cagaaggccttagagtatattagatttaggcatgataagttaggggatatcggtcgaata
gaaagacagcataaatttttagaagcactgctggaaagggtttataaccctaaagtttta
ttaaaaactcctaaattattaagccatattaggaataatgtagaaacagatttaccctgg
ttggagagtctgcaggcagctccggagttaattaaactgattacagatttggatcagaat
aaggtagggatggcaacattgccaggggaacctgaatatattgatggaattagctattgg
atccctgatcaactgttagtagatagagtagtagatagtctaattaatactaaagagtat
atacccaactctaaactgaatatatcgattttaaatggtaatggtaagcagggggctgct
taccaattagagactttattatccagttctgggtataatatagtccagacggctaatgcc
gatacctttaattatgttcaaacctgtatttattttaaccctaacgtttcggataaggct
caggaattagccggttatctgaaagggcgtttaattgagtgggaagatgtagatactaaa
aaagaagtcgatattaagattatcttaggagaaaattcaaatatcagttga

DBGET integrated database retrieval system