KEGG   Acetohalobium arabaticum: Acear_0977Help
Entry
Acear_0977        CDS       T01290                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
aar  Acetohalobium arabaticum
Pathway
aar00030  Pentose phosphate pathway
aar01100  Metabolic pathways
aar01120  Microbial metabolism in diverse environments
aar01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Acear_0977
Enzymes [BR:aar01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Acear_0977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ADL12506
UniProt: D9QPR5
LinkDB All DBs
Position
1057380..1059206
Genome map
AA seq 608 aa AA seqDB search
MYSWTGKLLRINLTERTSTVESLSCEDAEEYLGGRGLGTKIMMDEVAPEVDPLSADNKLI
FATGVLTGTIAPSSGRYMVITKGPLTGTIACSNSGGFFGAELKYAGYDAVIIEGEADRPV
YLWIYNDQVEIRDAEDFWGETTHDTTDMIRGETNEEAKVSCIGPAGENLVKMACIMNEMN
RAAGRTGVGAVMGSKNLKAVAVRGTNGVTVADNEGFMDTVRKARQMIEEHPVGGEGLPTY
GTNILVNILNESGGLPVNNFRDSGVFEMADKIGGETLAEENLIRNKGCYSCIIRCGRVTK
VTDPEYKGIGEGPEYEAAWGYGADCGVDNLNIITKANHLCNELGLDAISMPTTIACAMEL
YEEGYISQEEVDYDLCFGKEEILVELTRKTAYREGFGDELAEGSYRMAEKYGHPELSMSI
KKQEMPAYDPRTLQGIGLEYATSNRGGCHVRGYTTSPEILGVPEKIDPNATEGKAKWCVT
MQDLTAALDASGFCLFSTFGLDADIMAELLSTATGLDLSTEDFIKIGERIWNLEKIFNLA
AGFTKEDDTLPPRILEEPQKTGPYKGEVNRLDEMLPDYYELRGWNEESIPTIEKMEELNL
EEYYQSLE
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgtatagctggactggaaaattactccgaattaatttaactgaacgaacatctacagta
gagtctttatcgtgtgaggatgcagaagaatatttaggcggccggggattaggtactaag
attatgatggatgaagttgctccggaagtagatcctttaagtgctgataataaattaatc
tttgctactggtgtgttaacaggaactattgctccttcttcgggaagatatatggtaatt
actaaggggcctttgactggtacaattgcttgttctaattccggcggtttctttggagcg
gaattaaagtatgccggatatgatgcagtaattattgaaggagaagccgaccgacctgtc
tatctctggatttataatgaccaggttgagattagagatgctgaagatttctggggcgag
actactcatgatacgacagatatgattagaggagagactaatgaagaagcaaaggtttcc
tgtattggaccagctggagagaatttagtcaagatggcctgtattatgaatgaaatgaat
cgggcggccggcagaactggtgttggagctgtaatgggttctaagaatctcaaagcagta
gctgttagaggaactaacggagttacagttgccgataatgaaggctttatggatactgtt
agaaaagctcgtcaaatgattgaggaacatcccgtcgggggcgaagggttacctacgtat
ggtactaacattttagttaatatcctcaatgaatccggcggattacctgtcaataatttt
agagattcaggcgtctttgaaatggccgataaaatcggtggggaaactttagctgaagaa
aacctaattagaaataaaggttgttactcatgtattattcgatgtggccgggtaacaaag
gttactgatcctgagtataaaggcattggtgaaggtcctgagtatgaagcagcctggggt
tatggtgctgactgtggcgttgataatcttaatattattactaaagctaatcacttatgt
aatgaattaggactcgatgctattagtatgccgaccacgattgcttgtgctatggagctt
tatgaagaaggatatatttctcaggaagaggtagattatgatttgtgctttggtaaggaa
gagattctggtcgagttaacacgcaaaacggcttaccgggaagggtttggtgatgagctg
gccgaaggttcctatcgcatggctgaaaagtacgggcatccggaactttctatgagcatt
aaaaagcaagagatgccggcttatgatccgcgaactttacaggggattggtctagaatat
gctacttctaatcgcggcggctgtcatgtgcggggttatactacttccccagaaattttg
ggtgtgccggaaaagattgatcctaatgctacggaaggaaaggctaagtggtgtgttacc
atgcaagatttgacagctgctttagatgcatcagggttctgtttatttagtactttcggt
ttggatgccgatataatggctgaattactttcgacagcgactggtcttgatttatcaacg
gaagactttattaagatcggcgaaagaatttggaatttagagaaaatatttaatttagca
gctggctttactaaagaagatgatactttaccgccacgaatattggaagaaccacagaaa
actggtccttataaaggagaagtgaatcgtttagatgagatgttgcctgattactatgaa
ttacggggctggaatgaagagagtattccaacgatagaaaagatggaagaattaaatctg
gaggaatattatcaaagtttagagtaa

DBGET integrated database retrieval system