KEGG   Acetohalobium arabaticum: Acear_1517Help
Entry
Acear_1517        CDS       T01290                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
aar  Acetohalobium arabaticum
Pathway
aar00030  Pentose phosphate pathway
aar01100  Metabolic pathways
aar01120  Microbial metabolism in diverse environments
aar01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Acear_1517
Enzymes [BR:aar01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Acear_1517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ADL13024
UniProt: D9QR83
LinkDB All DBs
Position
complement(1612245..1614044)
Genome map
AA seq 599 aa AA seqDB search
MAGWMGQILRIDLSTEEATVEELDEELAKDYIGARGLGTKLFCDEVAPEVDPLSADNKLI
FATGPLTGTAAVSASRYNVVTKSPLTGTIAASNSGGYFPSEIKYAGYDVVIFEGEADRPV
YILIDDGEVEIKPAEDLWGLTTLETDNQLREEYGDGFKISAIGPAGEQQVKFACIMNDRE
RAAGRSGVGAVMGSKKIKAVMVRGSQGIKPADRDEFKEVLRDCLTKIEESGVTNEGLPAL
GTPVLVNIVNEHGNLPAENFQENVFDRAEKVSGEKLADELLVKNKACAGCPIGCGRVTAL
SSDKYEGFGEGPEYETIWAFGPDCGIDDLEAITKANYICNELGLDTITMGTTIACAMEMY
EEGIIDSDEIDLDLEFGNAEAMIEAVKLTGKKEGIGAKLAEGSKRVADSYGHPEYSMSSK
KQEYPAYDPRGSQGMGLEYATSNRGGCHVRGYLTSPEVLGIPEPVDPLTVEGKAELTKTF
QDLTAVVDSSGICLFTTFALGGEDIYKLLEAVTGAEYTQEEMMEAGERIWNLERQFNLEA
GIGPDEDKLAKRLLEEPAPKGAAEGRVVELDTMLAEYYELRGWTPEGEIKEEKKEALGL
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atggcaggatggatgggacagattttacggattgatctttctacagaggaagcaacagta
gaagagttggatgaagagctagctaaagattatattggtgcccgtggattaggtactaag
ctattctgtgatgaagtagcccctgaagtagatcctttaagtgctgataataaacttatc
tttgctactggtcctcttacaggaacggctgctgtttcggctagccgctataatgtggtt
actaaatcgccattaaccggtacaattgctgcttctaattcaggcggttattttccatct
gaaattaagtatgccggttatgatgtggtcatctttgaaggtgaagctgatagaccggta
tatattctgattgatgatggcgaagttgagattaagccggcagaagatctatggggctta
acgactctagaaactgataatcagctgcgggaagaatatggagacggttttaagatttca
gctatcggtccagccggtgaacagcaggttaagtttgcctgtattatgaatgatcgtgaa
cgggctgcaggtcgttctggagtaggagcagtaatgggctctaagaagattaaagcagta
atggtccgcggcagccagggaattaaacctgctgatagagatgaatttaaagaagtatta
agagactgcttaactaagatagaagaatctggagtaaccaatgaaggactgccggcttta
ggaactccagtattagtaaatatcgtcaatgaacatggtaatctaccggcagagaacttt
caagagaatgtattcgatagagcagagaaggtcagtggggagaagttagccgatgaattg
ttggttaagaataaggcctgtgctggctgtccgatcggctgtggtagagttactgccctc
tccagtgataagtatgaaggctttggcgaaggtccggagtatgaaacaatctgggctttt
ggaccggactgcggcattgatgatttagaggcaattactaaagccaactatatctgtaac
gaattaggactggatactatcacgatgggaaccactattgcctgtgctatggagatgtat
gaggaaggtattatcgacagtgatgagatagatttagatttggagtttggtaatgctgag
gctatgatagaggcagtgaaactgactggtaagaaagaaggaataggtgctaagctagcc
gaaggatctaagcgggtagccgatagctacggccatccggagtattctatgtccagcaag
aaacaggagtatcctgcctatgatccgcgtggttctcagggaatgggactggagtatgct
acctctaaccgcggcggctgccatgtgcgtggataccttacttcgccagaggtattggga
attcctgaacccgttgatccgcttactgtagaaggaaaggcagaactgactaagactttt
caggacttaacagcagtagttgattccagtggtatctgtctctttaccacttttgctctc
ggcggcgaagatatctataagctactagaagcagtcactggtgctgagtatactcaagaa
gagatgatggaagctggtgagcgcatctggaatctagaacgtcagtttaatttagaagcc
ggtataggtcccgatgaggataagctggctaagcggttattagaggaacctgcacctaaa
ggagcagcagaaggtagagtagtcgaactggatactatgttagcagaatattatgaacta
cgcggctggacgcctgaaggtgaaattaaagaagagaaaaaagaagctttaggcctataa

DBGET integrated database retrieval system