KEGG   Acetohalobium arabaticum: Acear_1673Help
Entry
Acear_1673        CDS       T01290                                 

Definition
(GenBank) chromosome segregation protein SMC
  KO
K03529  chromosome segregation protein
Organism
aar  Acetohalobium arabaticum
Brite
KEGG Orthology (KO) [BR:aar00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aar03036]
    Acear_1673
Chromosome and associated proteins [BR:aar03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Condensin-like complex
    Acear_1673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SMC_N SMC_hinge AAA_23 AAA_15 ATG16 Spc7 AAA_21 AAA_29 DUF1664 APG6_N DUF3450 MscS_porin GAS HMMR_N CENP-F_leu_zip ERM DUF5082 FUSC ABC_tran AAA_13 DUF3584 Laminin_II
Motif
Other DBs
NCBI-ProteinID: ADL13178
UniProt: D9QRN7
LinkDB All DBs
Position
complement(1764575..1768141)
Genome map
AA seq 1188 aa AA seqDB search
MHLKKIEMHGFKSFAEEVKVEFEPNITAVLGPNGSGKSNIADAIRWVLGEQSAKSLRGSK
MEDVIFAGSSQRKPMGIAEVTLTLDNSNGQLPIDYNEVTLGRRVTRSGKSEYLINNSVCR
LKDIEELIMGTGLGTEAYSIIGQGKVDEILSSKATERRLIFEEAAGITKHKQRKKEASRK
LEKTEQDLNRVNDIIGELEKRVGPLEKEAKKARKYKKYYEELKGLEVNLLLNKYSEIEAE
LTEVIETRTRFEDKISQVKAQVAEFDSKEEELNLELDKAIEAISLNKDEIYQTESDIERI
NNKLEIIKEKRNNADYRINQLENEIKDLRDEIKDLKRTEKENQKKLKTTENRLQEKQEEL
KTAEEELAAVTDRLEEKEGSKDSAEEDKLEYLNRINKKQNQVTNLTRQIKDIKEEKKEKQ
EEITEIEANIAAAKTELDELTAEISAIEDDLETEEEAVTAKKEQEEELETRLQKLQDEYN
QLDSKRNNYQSKLDVLENMQQKYQGYYRGVKNVLQYHQDNPEFAQLYGVVAELLEVPKEF
EIAIETALGSRLQNVVVATEEDAKEAINYLKREKAGRATFLPLNLVDPRSLRQREEEALE
VKGALGIAADLIDYQDKFSPVVKNLLGRIIIADNIDAAVTISKKTGQRVKVVTLEGEVVN
PGGSMTGGSSQNKNADLLGRSRQIEELSDRIDGLNQKLETLKEEGISVKDRLVSLTERKE
EQQEAVHQLDLDLTSKRKDYQQLKEEIERLETDRKQLNNYLNVLDKELSSLKNEKEDISS
QLADLTDGNQDIEGIITSIEEEIERIEAKKEEYNEEITDIKVKIASIEQEKNNLKQEADR
LQDQIQKAESGISNKKSEIEELRKRKEKLADQKIDFREDQNELKQQKKELEAKLADLKEK
KEGLTAEIKEIKEKSQGIRKELEEIQTEHNEYEVKEAQLEMELESIEEKLVDSYEVEIEA
EIDDREPIEDYEVVEERIEELKSAIDELGHVNLGAIEEYETLKERFSFMKEQHADLIEAR
NSLTEVINKIESRMEKKFKETFDEIKMKFEEVFTELFGGGQAELKLEDPDNLLETGIEIN
AQPPGKKLQKLSLMSGGEKALTAIALLFALLKVRPSPFYILDEIDAPLDEANVDRFTDFL
QNLSSLSQFIVITHRKGTMKAADALYGVTMQESGVSELVSLKLTELAS
NT seq 3567 nt NT seq  +upstreamnt  +downstreamnt
ttgcatttaaagaagatcgagatgcatggttttaagtcctttgctgaagaggtaaaggtg
gagtttgaaccgaatatcacggctgttttaggtcctaacggcagcggtaaaagcaatatt
gctgatgctattagatgggtattaggagaacagagtgctaagtcactgcgcggtagtaag
atggaagatgttatctttgccggcagcagtcagcggaaaccgatgggaattgcagaagta
acattgactttggataatagcaatggccagctgccgatagattataatgaagtaacattg
ggtagaagagttacccggtctggaaagagtgaatacttaattaataattctgtctgtcgg
ctaaaggatattgaagaattaattatgggtacaggcttaggaacggaagcttattctatt
ataggtcaaggtaaagttgatgaaattttaagtagcaaggctactgagcggcgattaatc
tttgaagaagcagctggaattactaaacataaacagaggaagaaggaagctagccgcaaa
ttagaaaagacagaacaggatcttaaccgggttaatgatattataggggaattagaaaag
cgggtaggaccgctggaaaaagaagctaagaaggctcgaaagtataaaaaatattatgaa
gaactaaagggattagaagtaaatctcttattaaataaatatagcgaaatagaagctgaa
ttaacggaagtaatcgaaactcgaaccagatttgaagataaaataagtcaggttaaggct
caggtagctgaatttgactctaaagaagaagaattaaacttggaattggacaaggctatt
gaagcaattagtctgaataaagatgagatttatcagacagaaagcgatattgagcggatt
aacaataaattagagattattaaagaaaagagaaataatgctgattatagaataaaccaa
ctggagaatgaaatcaaagatttaagagatgaaataaaagatttgaaaagaactgaaaag
gaaaatcaaaagaaattaaagacaacagagaacagattacaggaaaagcaagaagagttg
aagacggctgaggaagagttagcagctgtaactgatagattagaggaaaaggaaggaagt
aaggattcggctgaggaggacaagctggagtatctaaaccgtattaataagaagcagaat
caggtaacaaatcttacacgtcagattaaagatattaaagaagagaagaaagaaaagcag
gaagagataacagagatagaagcaaatattgctgcagccaagactgaattggatgaatta
actgcggaaatatcagctatagaggatgatttagaaactgaagaggaagcagtaacagca
aagaaagagcaagaggaagaattagaaactaggttgcagaaactgcaggatgaatataat
caacttgactcgaagcggaataattaccaatctaaactggatgtattggagaatatgcag
cagaagtatcagggatactatcgcggagttaagaatgttttgcagtatcatcaggataat
cctgagtttgctcagctatatggagtagtagcggaattattggaagtgcccaaagagttt
gaaatagcaattgagactgctttaggaagtaggctccagaatgttgtagtggctaccgaa
gaggatgctaaagaagcaattaattatttaaaaagagagaaggctggacgggctaccttt
ctgccacttaatttagttgatccccgcagtctgcgccagagggaagaagaagcgctagaa
gttaaaggagctttgggaatagcggctgacttgattgattatcaagataaattcagtccg
gtggttaaaaacttattaggtagaataataatagctgataatatagatgcggcagttact
atttccaaaaagacgggacagagagtaaaagtagttactttagaaggagaagttgttaat
cccggcggttcaatgacaggcggaagttcacagaataaaaatgctgatttattagggcgc
agccgacagattgaggagttatctgataggatagatgggttaaatcagaagttagagact
ttaaaagaagaagggatttcagttaaagatagattagtttcgcttactgaaaggaaagaa
gaacaacaggaagcagttcatcaactggatttggatttaaccagcaagcgcaaagattat
cagcagcttaaagaggagattgaacgattagagactgacaggaagcagctgaataattat
ctcaacgttctagataaagaattaagttctctaaagaatgaaaaagaggatataagcagt
caacttgctgatttgactgatggtaatcaggatattgaaggaataattacttctattgaa
gaagaaattgaaagaattgaagctaaaaaggaagagtataatgaagagattactgacata
aaggttaagatagcttccattgaacaggagaagaataacttaaaacaggaagctgatcgg
ttacaggaccagattcagaaagctgaatcgggaattagcaataaaaagagtgaaattgaa
gaattaagaaaaagaaaggaaaagttagctgatcagaagatagattttagggaagaccag
aatgaattaaagcagcagaagaaagaattagaagccaaactggctgatttaaaagaaaag
aaggaaggccttacagctgaaattaaagagattaaagagaagtcacaagggattaggaag
gaattagaggaaatccagacagaacataatgaatatgaagtaaaagaagcccagttggag
atggagttagaaagtatagaagagaaattagttgacagttatgaagtagaaatagaagct
gagatagatgatagagagccgattgaagattatgaagtagtggaggagagaatcgaagaa
ttaaagtcggctattgatgagctaggccatgtaaatttaggtgctattgaagagtatgaa
accttaaaagagaggtttagctttatgaaagaacagcatgctgatttaattgaagcccgc
aattcacttacagaggtcattaataagatagagagcagaatggagaagaaatttaaagag
acttttgatgagataaagatgaagtttgaagaggtgtttactgaattattcggcggcgga
caggctgaattaaagttagaagatcctgataatctgctggagacgggaatcgagattaat
gcccaacctcctggtaaaaaactgcagaaattatccttaatgtcgggtggtgaaaaggca
cttacagctattgctttattatttgctttattgaaggtaaggcctagtcctttttatatt
ctggatgagatagatgctccactagatgaagccaatgtagatcggtttactgattttctg
cagaatctatcctcattatctcagttcatcgttattacccaccgcaaggggacaatgaaa
gcagcagatgctttatatggcgttacaatgcaggagtcaggcgtatctgagttagtatca
cttaagttaactgaactggctagttag

DBGET integrated database retrieval system