KEGG   Acetohalobium arabaticum: Acear_2055Help
Entry
Acear_2055        CDS       T01290                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
aar  Acetohalobium arabaticum
Pathway
aar00970  Aminoacyl-tRNA biosynthesis
aar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aar00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Acear_2055
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:aar03029]
    Acear_2055
Enzymes [BR:aar01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Acear_2055
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Acear_2055
Mitochondrial biogenesis [BR:aar03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Acear_2055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase Apolipoprotein
Motif
Other DBs
NCBI-ProteinID: ADL13545
UniProt: D9QT45
LinkDB All DBs
Position
complement(2152029..2153486)
Genome map
AA seq 485 aa AA seqDB search
MKLYELTAHELNERLIAGEVSAQEIVESVYQRIDEVEDDVQSYITLTKDEALKQAKEVDE
KLANGEEVNSLAGIPVAIKDNMCTKGVKTTCASNILHNFEPPYNATVVDKLNEVDTVMTG
KTNLDEFAMGSSTENSGFFTTKNPWDLDYVPGGSSGGSAAAVAAGEAVISLGSDTGGSIR
QPASLCGVVGMKPTYGFVSRYGLVAFASSLDQIGPFSRDVTDCALALNCLCGHDPQDSTS
VEREVPDFTESLVDDVSDMKIGVPKEYFGEGIDGEVEEAVQSAIDKLEELGATCEEVSLP
HTEYALPAYYLIAPAEASSNLARYDGVRYGYRNEEADGLVDMFKLTRSEGFGDEVQRRIM
LGTYALSSGYYDAYYLKAQKVRTLIKQDFEEAFADYDVLISPTSPTTAFKIGEKSDDPLQ
MYMSDLCTIPANLAGLPGVSIPCGFDSAGLPIGLQILGDHFAEEKLIQVAYTFEQNTDFD
TRAEL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatatgaactaacggcccatgaattaaatgaacgattaatagcaggtgaggtt
agtgctcaagagatagttgaatctgtttatcaacggattgatgaagtagaagatgatgtt
cagtcctatataacattaaccaaagatgaagcattaaaacaagccaaggaagttgatgaa
aagttagctaatggtgaagaagttaattctttagcaggaattccggtagctataaaggat
aatatgtgtactaaaggagttaagactacctgtgcttctaatatcttacataattttgaa
ccgccttataatgctactgtagtggacaagctgaatgaagtcgatacggtaatgaccggc
aagacaaatttagatgagtttgctatgggatcatctacagaaaattccggcttctttact
actaaaaacccctgggatttagattatgtaccaggcggttccagtggaggttcagctgca
gctgttgctgctggcgaagcagttatctctttaggttcggatacaggaggttctattaga
cagccggcttccttatgtggagtagtaggtatgaagccgacttatggttttgtttcgcgg
tatggtttagtagcctttgcctcatctttagatcagatcggtcctttcagtcgggatgtt
actgactgtgcgctggccttaaactgtctttgcggccatgatccacaggattccacttca
gttgaacgagaagtacctgactttactgaatctttagtagatgatgtttccgatatgaag
attggagtgcctaaggaatattttggggaagggatagatggtgaagtagaagaagctgtt
cagtcggctattgacaagttagaagaattaggtgcaacctgtgaagaggtttcgctgccc
catactgagtatgctctgccagcctattatctcattgctccggcagaagccagttctaat
ctggcccgctatgatggagtaagatatggatatcgaaatgaagaagccgatggattagtt
gatatgtttaagctgacaagaagtgaaggattcggtgatgaggtacagcgtagaattatg
ttaggaacctacgctttaagctctggttattatgatgcttattatctaaaggcccagaag
gtaagaaccttaattaagcaggattttgaagaagcttttgctgactatgatgtcttgatt
tcaccgacttcaccgactactgcttttaaaataggcgagaagagtgatgatccattacag
atgtatatgtctgatctatgtacaattcctgctaatttggccggactacctggagtctcc
atcccctgtgggttcgatagtgcaggattgccgatcggactacagatattgggtgatcac
tttgctgaagagaaattaattcaggttgcttatacatttgaacagaatactgactttgat
acaagagcggaactgtaa

DBGET integrated database retrieval system