KEGG   Candidatus Amoebophilus asiaticus: Aasi_0921Help
Entry
Aasi_0921         CDS       T00730                                 

Definition
(GenBank) hypothetical protein
Organism
aas  Candidatus Amoebophilus asiaticus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sel1 TPR_16 TPR_14 TPR_2 TPR_1 TPR_12 TPR_10 DUF4411
Motif
Other DBs
NCBI-ProteinID: ACE06287
UniProt: B3EST5
LinkDB All DBs
Position
1177610..1181455
Genome map
AA seq 1281 aa AA seqDB search
MKYKRRLGKWLSAHILVLGILVFLAVGLPLQSCFESYNPVIPSSKTPKDTNAKSAIQLSS
PLSKNSQDAYLSLENELSIPSSSKDLSLDKIREEQIAPINQNEVPSFTTLPSYLSTPMVG
SSVDNRATPVNPPAEKQQSVQVKNSLKQNRNLQITSQTAKDQREAKEQILQEKEAQLLSK
AFRTRQGYIVKFYKEAGVWKANVVEEVGNFKGEFDLPAYLGEDENLAQNIERLLNLDRSA
QAMTSLIQIVLPNISKGQEGYVYIGGLSGGGRKKGEKQQEPKKQADKVGSKETKEKKKKS
TQSKQEALGKRQKSDVENRKRKKESTQEKKELKTKKRRDKLEEESEEEKEEKRKKVSGKG
STEKGKKRKQKSLQKGLKKEAEGEDEYSPAEASKEEGTKKARVTRSDSEKIKFEVNKEQE
ERLRIVQYLDKNLSERDSIFDQAQKKDKVAQYEWAQYQLGRYYVALEEEKDPDEIGRILK
EAIRWYIKAVLNGHQEAPRILRELKDTNSFQRFRNSQSIKKIINNYTIKAGKSSEEAKRV
QQALIGLRDSGLYSNPDDQVMGWYEQAVNATIGSAFALKDFEEFKKEAEDRYKKYERTIQ
DRKIKRNSGTEPTWRGLMRVSDLIVMDLDPSKMPMHIEWGGDPTISPNASGIFGPLFVLP
NSQEYEDVVMTIDPSGDGPDETAYCVAKRSGDYYFIIDVGGLAGGYHPKDSKDRIGNSTK
VLRALISIARENKVNTVIIENNNDKSFGKLLKKELKKQGEGDLEIISDHQKHNKEKRIIV
RLQPLLNEHRLIINKRTLQKDFDSKLTKDLNYKFFYQLMSVVENKKKSKKYFDGGNPQHD
DRVDAVADAIHYLKERKDEFDQLKEKWKQLKDKAEQGDIKALIEVARRYKDGVGTAVNYE
EARQWYEKAKKQGPAADQEAYAEALFSLAQMYQTSLIKVEEKETEKGKEKESGELQIAIE
LYQQADERGHAGAAYELGKLYQNGEGVEKNEEEVAKFFKKAAKIGHPGGEYELGRVYEDK
KQYKEAHKYYRRAANHNNADAQFSLAQMYRENLVKVEGRESEKEKGKEKKEDENFSLKEV
VKLYQEAAKQGHAEAAYELGQVYETELGEVKQNYGKARKWYQVSAQGGNAKAQYSLGRIY
QNGCGLRRKDEVQASIWYKAAAKQGHREAQFELGRMYENTKDYAEARKWYEMAADQNHVG
AQFNLAGMYRDGKGGDKNEDTAVRLYKAAAKQEYADANIQLGWMYDHGKGVEKDPSKALE
YYRKEAELKNKEEKDQVKEGS
NT seq 3846 nt NT seq  +upstreamnt  +downstreamnt
atgaaatataaacgtcgattaggtaagtggctgagcgcccatattttagttctaggaata
ctggtgtttttagctgtagggttacctttacaaagttgttttgaatcctataatcctgtt
attcccagttcgaaaactccaaaagatactaacgctaaatcagctatacaactttcctct
ccattatcaaaaaattcacaagatgcgtatttatccttagaaaatgagcttagcattcct
tctagttccaaagatttatcccttgataagatacgagaggagcaaatagcacctattaat
caaaacgaagttccctcgtttacaacattgcctagttatttgtccacgcctatggttggg
agtagtgttgataatagagcaactccggtaaaccctcctgctgaaaaacaacagagtgtt
caggtgaaaaactctttgaaacaaaatagaaacttacaaattacaagccagacagctaaa
gatcaaagagaagccaaagagcaaatcctacaagaaaaagaagctcagctgttaagtaaa
gcttttagaactaggcagggatatatagttaagttttacaaagaagcaggagtatggaaa
gctaatgtagtagaagaggtaggaaattttaaaggagaatttgatttgccagcttattta
ggcgaagatgaaaatttagcgcaaaacatagaaagattacttaatctagataggtctgcc
caagctatgacaagccttatacaaattgttttgcccaatatttctaaaggacaggagggc
tatgtatatataggcggtttgtcaggaggaggcagaaagaaaggcgaaaagcaacaagag
cctaagaaacaagcagataaagtaggaagtaaggagactaaagaaaaaaagaaaaaatca
acacaatcgaagcaagaagcattaggtaaaagacagaaaagtgatgtggaaaataggaaa
aggaaaaaagaatcaacccaagagaaaaaagaattaaaaaccaaaaagagaagagataag
ctagaggaagaaagtgaagaagaaaaggaagaaaaaaggaagaaggtaagtggaaaagga
agtacagaaaaagggaaaaaacgtaaacaaaaatctctacaaaagggattaaaaaaggaa
gctgaaggagaggatgagtattcgcctgcggaagcaagcaaggaagaaggtactaaaaaa
gctagagtaacacgttctgattcagaaaaaataaaatttgaagttaataaggagcaagaa
gaaaggttaagaattgtacagtatttagacaaaaatctatcagaaagagactcaattttc
gaccaggctcagaagaaagataaagtggcccaatatgaatgggctcagtatcaattaggt
cggtattatgtggcactagaagaagaaaaagatccagatgaaataggccgaattttaaag
gaagctattaggtggtatataaaagctgtccttaatggtcatcaagaagcaccacgcata
cttagggaattaaaagatactaattcttttcaaagatttagaaatagccaaagcataaag
aaaattattaacaattatactattaaggctggtaaaagtagtgaagaagcgaaaagagtt
cagcaagcacttataggtttaagggatagtggtctctatagtaaccctgatgatcaagta
atgggttggtatgagcaggctgtaaatgctactattggttcagcgtttgctttaaaagat
tttgaagaatttaaaaaggaagcagaagacagatataagaaatacgaaagaacaatacag
gatagaaaaatcaaaagaaattcaggtactgaacccacatggcggggtcttatgagggta
tctgatttaattgttatggaccttgatccttccaaaatgcctatgcatattgaatggggc
ggagatcctaccatttctcctaatgcaagtggtatatttggacctctgtttgtgcttcca
aattcccaggagtatgaagatgtagtcatgactattgatccttctggagatggtcctgat
gaaacagcttattgtgtggctaagcgtagtggagactattattttattatagatgtaggt
ggattagctggaggttatcatcctaaagattcgaaagataggataggtaatagcactaaa
gtcttaagagcattaatatcaattgctcgcgaaaataaggttaatactgtaatcattgaa
aataataatgataaatcttttgggaaactgttgaaaaaagagttgaaaaaacaaggagaa
ggggatttagagattatttcagatcaccaaaagcacaataaagaaaaacgaattatagtt
aggctccaacctctattgaacgaacatagacttattattaacaagaggacacttcaaaag
gattttgactcaaaattaacaaaagatttgaattataaatttttctaccaattaatgtca
gtggtagaaaataaaaaaaaatctaaaaaatattttgatgggggaaaccctcaacatgat
gatcgagtagatgctgtagcagatgcaatacattatttaaaggaaagaaaagatgaattc
gaccaattaaaagaaaaatggaaacaacttaaagataaggctgaacaaggagatataaaa
gcactgattgaggtggctaggaggtataaagacggcgtgggaacagcagtaaattatgag
gaagcacgtcaatggtatgaaaaggctaagaagcaaggtcctgctgctgatcaggaagct
tatgctgaagcactgtttagcttagctcaaatgtatcaaacgagtttgataaaagtagaa
gaaaaagaaacagagaaagggaaagaaaaagagagtggcgaactacaaatagcaattgaa
ttgtatcagcaggcagatgaaagaggacatgcaggagcggcatatgagttaggtaaattg
taccaaaatggcgagggggtagaaaaaaatgaagaagaagtagctaaatttttcaaaaaa
gcagcgaaaataggtcacccggggggtgaatatgaattgggtagggtttacgaagataaa
aaacagtataaggaagcacataaatattatagaagggctgctaatcataataatgcagat
gcacagtttagcttagcacagatgtatcgagagaatttagtaaaagtagaagggagggaa
agtgagaaagaaaagggaaaagagaaaaaagaagacgagaatttttcattaaaagaagta
gttaagttgtaccaagaagcagctaaacaaggccatgcagaagcagcctacgaactagga
caagtatacgaaactgagttaggagaagtgaaacagaattatggaaaagcgcgtaaatgg
taccaagtgtctgctcagggagggaatgctaaagctcaatatagcctaggtagaatatat
caaaatggttgtggcttacgtaggaaagacgaagttcaagcctctatatggtataaagca
gcagctaaacaaggccatagagaagcacaatttgaactaggtaggatgtacgagaatact
aaagattatgctgaagcacgtaaatggtatgaaatggctgctgatcaaaatcatgtaggg
gcacagtttaacctggcagggatgtatagagatggtaagggaggagacaagaatgaagat
acagcagttagactctataaagcagcagctaaacaagagtatgcagatgccaatattcaa
ctaggttggatgtatgatcatggaaagggagtagaaaaggatcctagtaaagcattagaa
tattatagaaaagaagctgaattaaagaataaagaggaaaaagatcaggttaaagagggt
agttag

DBGET integrated database retrieval system