KEGG   Candidatus Amoebophilus asiaticus: Aasi_1367Help
Entry
Aasi_1367         CDS       T00730                                 

Definition
(GenBank) hypothetical protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
aas  Candidatus Amoebophilus asiaticus
Pathway
aas00550  Peptidoglycan biosynthesis
aas01100  Metabolic pathways
aas01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:aas00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Aasi_1367
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Aasi_1367
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Aasi_1367
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aas01011]
    Aasi_1367
Enzymes [BR:aas01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Aasi_1367
Peptidoglycan biosynthesis and degradation proteins [BR:aas01011]
 Precursor biosynthesis
  Amino acid ligase
   Aasi_1367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 RimK ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ACE06671
UniProt: B3ETW9
LinkDB All DBs
Position
1743309..1744574
Genome map
AA seq 421 aa AA seqDB search
MRIGIIMGGFSAERHISVESGRNVYEKLASSGTYTPIPIFLTGTPLQHSLFILPIHILLK
DSADDIHERLKHISTTTDNSTNWTEEPAIDSIIKKYVGSFTMQPTAITYQELAHLVDSVF
IALHGRPGEDGTLQAILEQHGLPYNGSGVTTTSLTIDKFATNRFLHKHGIYVANQAVVTI
DQWKNNTPATIETIEATFKYPFIVKPVDDGCSVAVFKIQNKDMLIAYAENIFRADSNQPT
NLTQVLGLKPNAAFPNYQQFLVEDLIEKGTATHFLEITGGLLTHLDEQGNRQYEMFEPSE
VVATGDILSLEEKFLAGEGQNITPARFHPDPTTNLAISTKVKEDLQKVAQLVNIEGYARI
DAMVKIYPTHIETWIIEINTLPALTPATCIFHQCAINGYTPFDFIHTIIQYGYKKARIAT
I
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgcgcataggtattattatgggcggcttttcagccgaacgccatatttctgtagaaagc
gggagaaatgtatatgaaaagctggcttcttctggaacatacacacctattcctattttt
ttgactggtacacccctacaacattcactatttattttacccattcatattttgctaaaa
gatagtgctgacgatattcatgaaagactcaagcatatttctactactacggacaattca
actaattggactgaagagccagccatagattcaattattaaaaagtatgtaggttcattt
accatgcagcctacagctataacctaccaagaattagcacatttagtagacagtgttttt
attgctttacacgggcgaccaggagaagatggaactttgcaagctattttagaacagcat
gggttgccctacaatggttcaggggtgacaaccacaagccttaccattgataaatttgct
actaaccgctttttacataagcatgggatatatgtagccaatcaagctgtggttacaata
gaccaatggaaaaacaatacgccagcaactatagagactattgaagccacttttaaatat
ccatttattgttaaacctgtagatgatggctgtagtgtagctgtgtttaagattcaaaat
aaagacatgcttatagcttatgcagagaatatatttagagcagattctaaccaacctact
aatcttacacaagtattaggtttaaaacccaatgcagcttttcctaattatcaacaattt
ttggtagaagatctaatagaaaaagggacagccacacattttttagaaattacaggagga
cttctaacacatttagatgaacaaggaaatcggcaatatgaaatgtttgaaccttctgaa
gtagttgccactggcgatatactgtcgcttgaagagaagtttttagcaggtgagggacaa
aatattacaccagctagatttcatccagatcctactaccaaccttgctatctctacaaaa
gttaaagaagatctgcaaaaggtagcgcaactagtaaatattgaagggtatgctcgtatt
gatgccatggtaaaaatatatcctacacacatagaaacttggattattgaaattaatacc
ttaccagcacttacacctgctacttgtatttttcaccaatgtgctataaacggttatacg
ccttttgattttatacatactattattcaatatggatataaaaaagctcgtatagcaacc
atataa

DBGET integrated database retrieval system