KEGG   Acetobacter ascendens: A4S02_07645Help
Entry
A4S02_07645       CDS       T05523                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
aasc  Acetobacter ascendens
Pathway
aasc00473  D-Alanine metabolism
aasc00550  Peptidoglycan biosynthesis
aasc01100  Metabolic pathways
aasc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:aasc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A4S02_07645
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A4S02_07645
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    A4S02_07645
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aasc01011]
    A4S02_07645
Enzymes [BR:aasc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     A4S02_07645
Peptidoglycan biosynthesis and degradation proteins [BR:aasc01011]
 Precursor biosynthesis
  Amino acid ligase
   A4S02_07645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 B12-binding CPSase_L_D2 UPF0180
Motif
Other DBs
NCBI-ProteinID: AOW46662
UniProt: A0A1D8QWD7
LinkDB All DBs
Position
1591001..1591939
Genome map
AA seq 312 aa AA seqDB search
MNAPKRVTVLMGGMSSERVVSLSSGQGVAEALRSKGYEVCTLDAQADLATLVETLNAQKP
DVVFNALHGRFGEDGSIQGILDWMGIPYTHSGIRASATAMDKAAARAIFQTAGLPVAEGM
VVDIATLADTDPLPTPYVVKPLNEGSSVGVSIVRTGSNTRADIVKNWTYGPQALVEAFIP
GREITVGVMGDRALTITDITPTGTGHDFYDYDSKYQVGGSAHVLPAKIDTASAKLALEVA
VRAHQALGCSGASRSDFRLDDTNPDQPHLILLEVNTQPGMTATSLLPEQAAYCGISYPEL
CAWLVEQATCRQ
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaccaaaacgcgttaccgtgctgatgggtggcatgtcttccgaacgggtggtc
agcctttcatccgggcaaggtgtggctgaggctctgcgcagcaaagggtatgaagtttgc
acgctggatgcccaagcggatttggccacattggttgaaacactgaatgcacaaaagccg
gatgtagtgtttaacgccctgcatggccgttttggtgaagatggcagcattcaaggtatt
ctggactggatgggtattccctatacccattcgggcattcgggcctctgccactgctatg
gataaagccgctgcccgcgctatttttcaaacagccgggctacctgtggcagaaggcatg
gtggtagatattgccacccttgcagatacagaccccctgcccaccccctatgtggtgaaa
ccgctcaatgaaggctcatccgttggggtttccattgtgcgtacggggtccaacacgcgg
gcagatattgttaaaaactggacttatggcccgcaggctcttgtagaagcttttattccc
ggccgggaaattaccgtaggcgttatgggcgatcgtgcccttaccatcacggatattacc
cctaccggcactggccatgatttttacgactatgattccaaatatcaggtcggtggctct
gcccatgttctgcccgcgaaaattgataccgccagcgccaaacttgcgctggaagttgct
gtaagagcgcatcaggctttggggtgttctggtgcatcgcgctctgatttccgattggat
gataccaatccagatcagccgcacctcattctgctggaggtcaacacgcagccgggtatg
acggcaacatcactgctgcccgaacaggccgcctattgtggtatcagctacccagaactt
tgcgcgtggctggttgagcaggctacctgccgacaatga

DBGET integrated database retrieval system