KEGG   Aggregatibacter actinomycetemcomitans D11S-1: D11S_1976Help
Entry
D11S_1976         CDS       T00993                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
aat  Aggregatibacter actinomycetemcomitans D11S-1
Brite
Enzymes [BR:aat01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     D11S_1976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ACX83330
UniProt: C9R694
LinkDB All DBs
Position
1900178..1900753
Genome map
AA seq 191 aa AA seqDB search
MKIKTILAIVIGTICSAGIANAHEHKHDNMMMPLKGPSIEVKIQQLDPVNGNKDVGTVTI
TESSYGLVFTPNLKGLAEGLHGFHIHQNPSCEPKEKDGKLTAGLGAGGHWDPKDTKQHGY
PWQDDAHLGDLPALTVLHDGTAANPVLAPRIKHLDDVRGHSLMIHAGGDNHSDHPAPLGG
GGPRMACGVIK
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcaaaactattttagccatagtaatcggcacaatctgttctgcaggcattgct
aatgctcatgaacataagcatgacaacatgatgatgcctcttaaaggaccatctattgaa
gttaaaatacagcaattagatccggtcaacggcaacaaagatgtgggtacggtcactatc
accgaatccagctacggcttggtattcaccccaaatttaaaaggcttggcggaaggtttg
cacggtttccacattcaccaaaacccaagctgtgaaccaaaagaaaaagacggcaaactt
accgcaggtcttggcgcaggcggtcactgggatccgaaagacaccaaacaacacggctac
ccatggcaagatgacgcccatttaggtgatttaccggcattaaccgtattacacgacggc
acagccgctaacccggttttagccccacgcattaaacacttagacgacgtgcgcggtcac
tccctcatgatccacgctggtggcgataaccactccgatcacccggccccacttggcggc
ggcggtccgcgtatggcgtgtggtgtaattaaataa

DBGET integrated database retrieval system