KEGG   Paenarthrobacter aurescens: AAur_0283Help
Entry
AAur_0283         CDS       T00447                                 

Definition
(GenBank) ATP-dependent DNA ligase domain protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
aau  Paenarthrobacter aurescens
Pathway
aau03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:aau00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    AAur_0283
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aau03400]
    AAur_0283
Enzymes [BR:aau01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AAur_0283
DNA repair and recombination proteins [BR:aau03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AAur_0283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M LigD_N DNA_ligase_A_C DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ABM08006
UniProt: A1R1J1
LinkDB All DBs
Position
complement(292208..294763)
Genome map
AA seq 851 aa AA seqDB search
MAGKQQERVNVEGHELTLTNLNKIIYPETGTTKAEVLEYYAAVAPFLIPAAANRPVTRKR
WVNGVGTAENPGQVFFQKNLEDSAPKWIPRAAIQHSDHTNVYPMVNNLATLTWMAQIASL
EIHVPQWQVDPSGKPLRPDRFVLDLDPGPGAGLPECVEVAKLARSILQDMGMDPVPVTSG
SKGIHLYTGLDGTLKSEQVSAFAKELARALESDHPELVVSDMKKSLRHGKVLVDWSQNSG
NKTTIVPYSLRGKAHPTVAAPRTWRELSSPSLEHLDYVAVMKRVKTGKDHFAPISERHLP
PHGEDENDDDGTAGSSSGTGRSRERVVTVENRLAKYVGMRDPGKTPEPFPSSSAVSASPQ
SAGSSSDQPKPGDPPPPGGIFVIQEHHARRYHLDLRLEHHGVLASWALPRGIPETPDRNN
LAVHTEDHPMEYANFAGVIPKGEYGAGTMTIWDRGEYTCEKWRDGKEVIATLTGEPGGGL
GGTKRFALINTGQNWLIHLMKEQPGGRRGTQPAANAAAPKSAPAQPQPQPMPNYSPMLAT
SGTTADLRGDDWLYELKWDGIRAIITGTESRIRLMSRNGNDLTAAYPELTDRACWPDGDF
VADGEIVALGKGSRPDFGRLQLRMNLVKAADIERARATVPVQLMLFDLLYDDGTDLSGLP
FHERRERLSGFAERWRVGCPLHLSAVLDHDVEDLMTSAAELGLEGVMAKKADSRYVIGRR
SRSWIKLKLEQSQEVVVGGWRPGAGARAGTFGALLLGIPDGDKLHYVGRVGSGFKDWQLR
DIMEKLEPLAIVESPFADIPREDAAGATWVSPELVAEVTFGEWTGPGRLRHPVWRGWRPD
KSAGEVTLAGS
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
gtggcaggcaagcaacaggagcgggtgaacgtggaaggccacgagctcaccctcaccaac
ctgaacaaaatcatctacccggaaaccggcaccaccaaggccgaagtgctggagtattac
gccgcagtggcgcctttcctgatccctgccgctgccaaccggcccgtcacccgcaagcgc
tgggtcaacggagtgggtaccgccgaaaaccccgggcaagtgttcttccaaaagaacctt
gaggactcggcacccaaatggattccccgtgccgccattcagcattcggaccacaccaat
gtttatcccatggtcaacaaccttgcgacgctcacatggatggcccaaatcgcgtcgctg
gaaattcacgtaccgcagtggcaggtggatccttcagggaagccgctccgccccgaccgt
ttcgtcctggacctcgaccccgggcccggggcaggactgcccgagtgcgttgaagtggcc
aagcttgcccgttccatcctgcaggacatgggaatggacccggtccctgttaccagcggc
agcaaaggcatccacctctacactggcctggacgggacgctgaagtccgagcaagtgtcc
gccttcgccaaagagctggcccgtgccttggaatcggaccaccccgagctggtggtcagc
gacatgaagaagtccctccgacacggcaaagtgctggttgactggagccagaacagcggg
aacaagaccaccatcgtcccgtattcgctgcgcgggaaggcccaccctacggtcgccgcg
ccccgcacgtggcgggagctctcctctccttcgctggaacacctcgactatgtggccgtg
atgaagcgcgtgaagacaggcaaagaccacttcgcgccgatctccgaacgccacctgccg
cctcacggcgaggatgagaatgacgacgacggtactgccggaagcagttcaggcaccggc
cgttcccgcgagcgtgtggtgacagtagagaatcgtctcgccaagtacgtcgggatgcgc
gatccgggcaaaaccccggagccgtttccgtcgtcgtcggctgtttctgcctccccgcaa
tcggcgggctcctcctccgatcagccgaagcccggcgatcctccaccgcccggcggcatt
ttcgtcatccaggagcaccacgcccgccgctaccacttggacctgcgcctggagcaccat
ggcgtcctggcttcctgggcactgccgcgtggcatcccggaaacccccgaccgcaacaac
cttgccgttcacaccgaggaccaccccatggaatacgcgaacttcgcgggcgtcattccc
aagggtgagtacggggccgggaccatgactatttgggaccgcggcgagtacacctgcgag
aagtggcgcgacggcaaggaagtcatcgcgacgctcacaggcgagccgggtggtggcctt
ggcggcaccaaacggttcgcgctcatcaatacgggtcagaactggctgatccatctcatg
aaggagcagccgggcgggcgtaggggcacccaacccgcagccaacgccgcggcgcctaag
tccgctccggctcagccgcagcctcagcccatgccgaactactctcccatgctggccaca
tccgggaccaccgccgaccttagaggcgacgattggctgtatgaactcaagtgggacgga
atccgggcgatcatcaccggcacggagagcagaatccggctcatgagccgcaacggaaac
gatctcaccgccgcctatcccgaactgacggaccgcgcatgctggcccgacggcgatttc
gtggctgatggcgaaattgtggcgctcggcaaaggatcgcggcctgatttcggccggctg
cagctgaggatgaacttggtcaaagctgcggacatcgaacgtgcccgggcgacggttccg
gtgcagctcatgctgttcgatcttctgtacgacgacgggacggaccttagcgggctgcct
ttccacgagcgcagggagaggctttccggatttgcggagcgctggcgggtcggctgtccc
cttcacctttccgcggtgctggaccacgacgttgaggaccttatgacgagtgccgccgag
cttggcttggaaggagtcatggctaagaaagccgacagccgttacgtgattggacgccgc
agcaggtcctggatcaagctcaaactggaacagagccaggaagtggtggtgggcggttgg
cggcccggcgccggtgcacgggccgggaccttcggcgcgttgctgctgggcatcccggac
ggcgacaagctgcattacgtgggccgggtgggcagcggtttcaaggactggcagctcagg
gacatcatggagaaactggagcccttggctattgttgagtcgccgttcgcggacattccc
cgggaagacgctgcgggcgctacatgggtgagtcctgagctcgtggcggaagtgacattt
ggggaatggacgggccctggaaggctgaggcatccggtgtggcgtgggtggcgtccggac
aagtccgctggcgaggtaacgctggccggctcatga

DBGET integrated database retrieval system