KEGG   Paenarthrobacter aurescens: AAur_0764Help
Entry
AAur_0764         CDS       T00447                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
aau  Paenarthrobacter aurescens
Pathway
aau00620  Pyruvate metabolism
aau00680  Methane metabolism
aau01100  Metabolic pathways
aau01120  Microbial metabolism in diverse environments
aau01200  Carbon metabolism
Module
aau_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:aau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AAur_0764 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    AAur_0764 (ppc)
Enzymes [BR:aau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AAur_0764 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase Se-cys_synth_N PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ABM08058
UniProt: A1R2V3
LinkDB All DBs
Position
795077..797875
Genome map
AA seq 932 aa AA seqDB search
MVHTAHQDTDLAAELRADVRRVSTLLGESLVRQHGPELLQLVEQVRLLTKESKEAARGGA
DATGPWSAHDVVAQVRELLASLPLDQATDLVRAFAFYFHLSNAAEQVHRVRGLRTRQEKD
GWLAKAVSEIAGQAGPQVLQDVINGLDVRPIFTAHPTEASRRSVLDKVRKLSDVLAEPTA
EGTSARRRQDQQLAEIIDQMWQTDELRQVRPTPVDEARNAIYYLNSILTDAMPEMLTDLS
ELLAEHGVTLPAAAAPLKFGSWIGGDRDGNPNVTAAVTKEILQLQNQNAVRISIALIDEL
ISVLSNSTALFGADQELLDSITADLKNLPGLDKRILELNAQEPYRLKLTCIKAKLINTGR
RISASTYHEPGRDYATTPELLAEFGLLEASLRNHSAGLVADGALARVRRAIAAFGLHLAT
LDIREHADYHHDAVGQLVDRLGTEKAYGELTREERFTFLGAELASRRPLSGHPIKLEGTA
DGTYDVFRSIRQALHTYGPDVVETYIISMTRGADDVLAAAVLAREAGLIDLFSGKPHAKI
GFAPLLETVEELRASAEIVDQLLSDPSYRELVRLRGDIQEVMLGYSDSNKESGVMTSQWE
IHKTQRKLRDVAAKHGVRVRLFHGRGGSVGRGGGPTYDAIMAQPNGVLEGEIKFTEQGEV
ISDKYSLPELARENLELSLAAVMQGSALHRTPRTSDDERERYANVMETISDAAFARYRTL
IDDPQLPAYFLASTPVEQLGSLNIGSRPSKRPDSGAGLGGLRAIPWVFGWTQSRQIVPGW
FGVGSGLKAAREAGDTDQLLEMMDRWHFFRSVISNVEMTLAKTDMEIAGHYVSSLVPEEL
HRLFHMIRDEYELTVAEIERLTGEMELLDAQPTLKRSLEIRDQYLDPISYLQVELLRRVR
EEQLSGGEIDERLQRAMLITVNGVAAGLRNTG
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atggttcacactgcccatcaagacaccgatctcgctgccgaactgcgtgccgacgtacgc
cgggtttccacacttctcggcgagtccttggtacgacaacacggtccggaattgctccaa
ctcgtggagcaagttcgcttgctgaccaaggagtccaaggaagccgcacggggcggcgcg
gatgccaccggcccgtggagcgcgcacgacgtcgttgcccaggttcgcgagttgctcgcc
tccctgccgctggaccaggcgactgacctggttcgtgcctttgcgttttacttccacctc
agcaacgcggcggagcaagtacatcgcgtccgtggactgcgcacccgccaggaaaaagac
ggttggctggcgaaggcggtctcagagatagcgggccaggcgggaccccaggttctgcag
gatgtgatcaacggactcgacgtccgccccattttcacggcgcaccccaccgaggcttca
cgtcgttctgtgttggacaaggtccgcaaactttcggacgtccttgctgagcccacggct
gaggggacctccgcgcggcgccgtcaggaccagcaactcgctgaaatcatcgaccaaatg
tggcagaccgacgagctccgccaagtacgccccactcctgtggatgaggcccggaatgcc
atctactacctgaacagcattctgactgacgccatgccggaaatgctgacggacctttcg
gaacttctggccgagcatggtgtcacactccctgccgccgccgcaccgctgaagtttggt
tcgtggatcggtggcgaccgcgacggcaacccgaacgttactgctgctgtcaccaaggaa
atcctgcagttgcagaaccagaatgctgtccgcatcagcattgccctcatcgacgaactc
atctcggtactttccaactcaacggctctttttggggccgaccaagagctgctggattcg
atcaccgcggacctcaagaacctccccggactggacaaacgcatccttgaactgaacgcg
caggagccctacaggctcaagctgacctgcatcaaggccaagctcattaacaccggtcgc
cgcatttcagcttcgacgtatcacgagccgggccgcgactacgcaaccactcctgagttg
ctggcggagtttggactgcttgaagcctcgttgcggaaccattccgctggactggtggca
gacggcgccctggcccgcgtccgccgggcaatcgctgcctttggtctgcacctggcaacc
ttggacatacgtgaacacgccgattaccaccacgatgctgtggggcaactcgtggacagg
ctcggcaccgaaaaggcttacggcgaattgacgcgtgaggaacgcttcaccttcctgggg
gccgagctggcttcccgccgcccgctctccggccacccgatcaagcttgaaggcactgcg
gacggcacatatgacgtcttccggagtatccgccaggccctgcacacctatggcccggat
gtcgtggaaacctacatcatttccatgacccgcggcgccgatgatgtcctggccgcagca
gtccttgcccgcgaggccggtctgatcgacctcttcagcggcaagccccatgccaagatc
gggttcgctccgctattggaaacggtggaggaactccgggcctcggctgagattgtggac
cagttgctgtccgatccgtcctaccgggaacttgtccgcctccgcggagacatccaggag
gtcatgctgggttactccgattccaataaggaatccggcgtgatgaccagccagtgggag
atccacaagacccagcgcaagttgcgcgatgtggcggccaagcacggcgtccgcgttcgt
ctcttccacggccgcggtggatccgttggccgcggtggcggacccacctacgatgccatc
atggctcaaccgaacggcgtgctggaaggtgagatcaagttcaccgagcagggtgaggtc
atctcggacaagtactccctccccgagctggcccgcgaaaacctggagctctccctggcc
gccgtgatgcagggctcggcgctgcaccgcactccgcgtacatcggatgatgaacgtgag
cgctacgccaatgtcatggaaaccatctcggatgcagcgttcgcccgctaccgcacgctg
attgacgatccccagcttccggcgtacttcctggcgtccacacctgtggagcagctgggt
tcattgaatatcggttcccggccctccaagcgtccggattccggtgcgggacttggtggc
ctgcgggccattccgtgggttttcggctggactcagtcacgccagatcgttcccggctgg
ttcggagtgggctccggtttgaaggctgcgcgggaagccggcgacacggatcagttgctg
gagatgatggaccgctggcacttcttccggtcggtcatctccaacgtggagatgaccttg
gccaagacggacatggaaattgccggtcattacgtttcgtccctggtccccgaggaactg
caccgcttgttccacatgattcgtgacgagtacgagctcaccgttgccgagatcgaacgg
ctgacgggtgagatggagttgctggacgcccagcctacgctgaagcgttcactcgaaatc
cgcgaccaatacctggatccgatcagctatctgcaagtggagctccttcgccgcgtgcgc
gaggagcagctgtccgggggcgagatcgacgagcgcctccagcgggccatgctcatcacc
gtcaacggcgtagccgccggcctgcgcaataccggctag

DBGET integrated database retrieval system