KEGG   Paenarthrobacter aurescens: AAur_1244Help
Entry
AAur_1244         CDS       T00447                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase, iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
aau  Paenarthrobacter aurescens
Pathway
aau00020  Citrate cycle (TCA cycle)
aau00190  Oxidative phosphorylation
aau00650  Butanoate metabolism
aau01100  Metabolic pathways
aau01110  Biosynthesis of secondary metabolites
aau01120  Microbial metabolism in diverse environments
aau01130  Biosynthesis of antibiotics
aau01200  Carbon metabolism
Module
aau_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aau_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
aau_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:aau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AAur_1244 (sdhB)
   00650 Butanoate metabolism
    AAur_1244 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AAur_1244 (sdhB)
Enzymes [BR:aau01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AAur_1244 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     AAur_1244 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_7 Fer4 Fer4_9 Fer4_20 Fer4_6 Fer4_18 Fer4_4 Fer4_2 Fer4_16 Fer4_21 Fer4_15
Motif
Other DBs
NCBI-ProteinID: ABM06779
UniProt: A1R466
LinkDB All DBs
Position
complement(1328140..1328922)
Genome map
AA seq 260 aa AA seqDB search
MTTEMAEPASKIELPASVAGDGEIPTFHITLRVRRYDPEISDEARWDDYKLTMYGTDRVL
DALHKVKWEIDGSVSFRRSCAHGVCGSDAMRINGRNRLACKTLLKDLDTTKPITVEPIKG
LPVEKDLIVDMEPFFQSFREVMPFLINKGHEPTKERLQSVEDRERFDDTTKCILCAACTS
SCPVFWTDGQYFGPAAIVNAHRFIFDSRDDAGDMRLEILNDKEGVWRCRTTFNCSEACPR
GIQVTQAIAEVKQAILARKI
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgaaatggcagagcccgcttccaagatcgagctcccggctagcgttgccggc
gacggtgaaatccccaccttccacatcacgctgcgcgtgcgccgctacgaccccgaaatt
tcggacgaagcgcgttgggacgactacaagctgaccatgtacggcacggaccgcgtgttg
gatgccctccacaaggtcaagtgggagattgacggcagtgtttccttccgccgctcctgc
gcccacggtgtgtgtggttcggatgccatgcgcatcaacggccgcaaccgcctcgcctgc
aagacgctgctgaaggacctggacaccaccaagcccatcaccgtcgagccgatcaagggc
ctccctgtggagaaggacctgatcgtggacatggaacccttcttccagtccttccgcgaa
gtcatgccgttcctgatcaacaagggccacgagcccaccaaggaacgcctgcagtccgtc
gaggaccgtgagcgctttgacgacaccaccaagtgcatcctgtgcgctgcctgcacctcg
tcctgcccggtcttctggaccgacggccagtacttcggtccggctgcgatcgtcaacgcc
caccgcttcatcttcgattcccgtgatgacgccggcgacatgcgccttgagatcctgaac
gacaaagaaggcgtgtggcgctgccgcaccaccttcaactgctcggaagcatgcccccgc
ggcatccaggtgacccaggcaatcgccgaggtcaagcaggccatcctggcccgcaagatc
tag

DBGET integrated database retrieval system