KEGG   Paenarthrobacter aurescens: AAur_1245Help
Entry
AAur_1245         CDS       T00447                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
aau  Paenarthrobacter aurescens
Pathway
aau00020  Citrate cycle (TCA cycle)
aau00190  Oxidative phosphorylation
aau00650  Butanoate metabolism
aau01100  Metabolic pathways
aau01110  Biosynthesis of secondary metabolites
aau01120  Microbial metabolism in diverse environments
aau01130  Biosynthesis of antibiotics
aau01200  Carbon metabolism
Module
aau_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aau_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
aau_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:aau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AAur_1245 (sdhA)
   00650 Butanoate metabolism
    AAur_1245 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AAur_1245 (sdhA)
Enzymes [BR:aau01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AAur_1245 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     AAur_1245 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C
Motif
Other DBs
NCBI-ProteinID: ABM06323
UniProt: A1R467
LinkDB All DBs
Position
complement(1328922..1330670)
Genome map
AA seq 582 aa AA seqDB search
MRAAIESGQRARTAVLTKLYPTRSHTGAAQGGMCAALANVEEDNWEWHTFDTIKGGDYLV
DQDAAEVMAKEAIDAVLDLEKMGLPFNRTPEGRIDQRRFGGHTRDHGKAPVRRACYAADR
TGHMILQTLYQNCVKHNVEFYNEYYVLDLLIVEEDAVREDGTPYKQKRVAGVVSYDLASG
ELHVFQAKSVVFASGGAGKVFKTTSNAHTLTGDGMGIAFRRGIPLEDMEFFQFHPTGLAG
LGILLTEGARGEGAILRNSEGERFMERYAPTIKDLAPRDIVARAMANEVREGRGCGPNKD
YVLLDLTHLEPAHIEAKLPDITEFARTYLGVEPFTDPVPVFPTAHYAMGGIPTNITTEVL
QDNDTIVPGLYAAGEVACVSVHGSNRLGTNSLLDINVFGKRAGIAAAEYSKTADYVELPE
DPEAMTRGILDRLLTGNGTERVAQIRKELQDTMDANMQVFRTKESLEQVLRDIASFEERY
KHVTVQDKGKRFNLDLLEAVELGFLLDMAKVMTVGALHREESRGGHYREDFPDRNDEKFM
KHSMAYLDTSVTVDSSAESVAGIRLETKPVIFTRYEPMERKY
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccgcgatcgaatccggtcagcgagcacgcaccgcggtactgaccaagctctac
cccacccgctcgcacaccggtgcagctcagggtggaatgtgcgcagcattggccaacgtc
gaagaagacaactgggaatggcacacctttgacaccatcaaaggcggcgactacctggtt
gaccaggacgcagccgaggtcatggcgaaggaagccatcgacgccgtgttggaccttgaa
aagatgggtctgccgttcaaccgcacgcccgagggccggattgaccagcgccgcttcggt
ggccacacccgtgaccacggcaaggcacccgtccgccgcgcgtgctatgcagccgaccgc
accggccacatgatcctgcagaccctgtaccaaaactgcgtcaagcacaacgttgagttc
tacaacgagtactacgtccttgacctgttgatcgtcgaagaagacgcagtacgcgaagac
ggaaccccgtacaagcagaagcgtgttgccggcgtcgtgtcctacgacctcgcttccggt
gaactgcacgtcttccaggccaagtccgttgtgttcgcctccggcggcgccggcaaggtg
ttcaaaaccacctccaacgcgcacaccctcaccggtgacggaatgggcatcgcgttccgc
cgcggcatccccctggaagacatggagttcttccagttccacccgaccggcctcgccggc
ttgggcatcctcctcaccgagggtgcacgtggtgaaggtgccatcctgcgtaactcggag
ggtgagcgcttcatggagcgctacgctcccaccatcaaggacctcgcaccccgtgacatc
gtggcccgcgccatggcgaacgaagtgcgcgaaggccgcggttgtggtccgaacaaggat
tacgtcctcttggacctcacccacctcgagcccgcgcacatcgaagccaagcttccggac
atcacggagttcgcccgcacctacctgggtgtggaaccgttcaccgatcctgtccccgtg
ttccccaccgcgcactacgccatgggtggcatccccacgaacatcaccaccgaagtgctg
caggacaacgacacgatcgtgccgggtctctacgctgccggtgaagttgcctgtgtgtca
gtgcacggctcgaatcgtctcggcaccaactcgctcctggacatcaacgtcttcggtaag
cgcgccggtattgctgctgcggagtactcgaagacggccgactacgtcgagctccccgag
gaccccgaggcaatgacccgtggcatcctggaccgcttgctcaccggcaacggtaccgag
cgtgttgcacagattcgcaaggaactgcaggacaccatggacgccaacatgcaggtgttc
cgcaccaaggaatccttggagcaggtccttcgcgacatcgcttccttcgaagagcggtac
aagcacgtcaccgttcaggacaagggcaagcgcttcaacctggatctcctggaagccgtg
gaactgggtttcctgctggacatggccaaggtcatgaccgtcggtgcgctgcaccgtgaa
gagtcacgcggcggccactaccgcgaggacttcccggaccgcaatgacgagaagttcatg
aagcactccatggcgtacctggacacttccgtcaccgtcgactcctcggcggaatctgtt
gcgggcatccgtcttgagacgaagcccgtgatcttcacccgttacgagccgatggagcgt
aagtactaa

DBGET integrated database retrieval system