KEGG   Paenarthrobacter aurescens: AAur_1903Help
Entry
AAur_1903         CDS       T00447                                 

Gene name
tdh
Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
aau  Paenarthrobacter aurescens
Pathway
aau00260  Glycine, serine and threonine metabolism
aau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aau00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AAur_1903 (tdh)
Enzymes [BR:aau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     AAur_1903 (tdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: ABM06342
UniProt: A1R5Y9
LinkDB All DBs
Position
complement(2083982..2085025)
Genome map
AA seq 347 aa AA seqDB search
MRAVVKNAAERGVSYVTDAGDPKATEGSVVIEVGAASLCGTDRELYEWTPSAQAFNLNLP
VVLGHEGAGTVVEIGPGVTGLKVGDQVALESHLTCGQCFPCRTGDAHTCERTGILGMHID
GVFAEYAAVPQDICVKLPTGLSLESGALLEAAGVAVHAIQRANYSVAGRAVLVSGAGPVG
LVVVNLALLMGASHVIAVDPNPYRRAQAEKLGATALHPNDGIVERCRELTGRRGGFDVAF
ECSGAPGTLATLFEAVRREATVITVGHPSRPAEVDIAAYINKKGITLRGIFGRRLWETWE
QSLLLLDSGKLELDWLITHRMKLSQIDEAVELLTGDACKVLLIPNLG
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcagtagtcaaaaatgcagccgaacgaggcgtctcatacgtcaccgacgccggc
gaccccaaggcaaccgagggatcggtcgtcatcgaagtcggcgctgcctccctctgcggc
accgaccgcgaactctacgaatggaccccctcagcccaagccttcaacctcaaccttccg
gtggtcctcggccacgaaggcgcgggcaccgtcgtcgaaatcggccccggcgtcaccggc
cttaaagtcggcgaccaagttgccctcgaaagccacctgacctgtggccagtgcttcccg
tgccgcaccggagacgcccacacctgcgaacggaccggcatcctgggcatgcacatcgac
ggcgtcttcgccgaatacgccgccgtgccgcaggacatctgcgtcaaactccccaccggc
ttgtccttggaatccggcgcccttctcgaagcagccggcgtcgcagtccacgccatccag
cgggccaactactccgtggcaggccgggcggtgctcgtcagcggggcaggcccggtgggt
ctcgtcgtggtgaacttggctctactcatgggcgcctcccacgtcatcgccgtcgacccc
aacccctaccgccgcgcccaagccgaaaaactcggcgcaaccgcgctgcaccccaacgac
ggcatcgttgaacgctgccgcgaactaaccggccgccgcggcggtttcgacgtcgccttc
gaatgctccggagcaccaggcacactggcaaccctcttcgaagccgtccgccgggaagcc
accgtcatcaccgtcggacaccccagccgccccgcggaagtcgatatcgcggcgtacatc
aacaaaaagggcatcacattgcgcggcatcttcggccgccggctctgggaaacctgggaa
caaagcctgctgctactggactccggaaaactggaacttgactggctcatcacccaccgc
atgaaactcagccaaattgacgaagccgtagagctcctcaccggagacgcctgcaaagtc
ctgctcatcccgaacctcggctga

DBGET integrated database retrieval system