KEGG   Paenarthrobacter aurescens: AAur_2813Help
Entry
AAur_2813         CDS       T00447                                 

Definition
(GenBank) putative Aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
aau  Paenarthrobacter aurescens
Pathway
aau00220  Arginine biosynthesis
aau00250  Alanine, aspartate and glutamate metabolism
aau00290  Valine, leucine and isoleucine biosynthesis
aau01100  Metabolic pathways
aau01110  Biosynthesis of secondary metabolites
aau01130  Biosynthesis of antibiotics
aau01210  2-Oxocarboxylic acid metabolism
aau01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aau00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AAur_2813
   00290 Valine, leucine and isoleucine biosynthesis
    AAur_2813
   00220 Arginine biosynthesis
    AAur_2813
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aau01007]
    AAur_2813
Enzymes [BR:aau01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     AAur_2813
    2.6.1.66  valine---pyruvate transaminase
     AAur_2813
Amino acid related enzymes [BR:aau01007]
 Aminotransferase (transaminase)
  Class I
   AAur_2813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ABM08222
UniProt: A1R8G1
LinkDB All DBs
Position
complement(3095455..3096675)
Genome map
AA seq 406 aa AA seqDB search
MANFKQSTKLHNVLYDIRGPILQAAQQMEAEGHRILKLNIGNPAPFGFEAPDAILVDMIR
HLPNAQGYSDSRGIFSARTAVSQYYQTRGIQNIHVDDIYLGNGVSELITMSLMALLDDGD
EVLIPTPDYPLWTASVALAGGRPVHYLCDEESGWQPDLEDMEAKITPRTKGIVVINPNNP
TGAVYPEETLKKIVALAEKHGLVLFADEIYEKILYEDAVHINLAGLTGDDVLCLTFSGLS
KAYRVCGYRAGWMAISGPKKDAADYLEGINLLANMRLCANVPAQHAIQTALGGYQSINDL
ILPGGRLLEQRNKAYDLLNAIPGVSTQQARGALYLFPKLDPEVYHIRDDEKFVLDLLKEQ
KILVSHGRAFNWVRPDHFRMVTLPNVKDIEEAIGRMADFLSRYPGN
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatttcaagcagtccaccaagcttcataatgtcctctacgacatccgtggaccg
attcttcaggccgcccagcaaatggaagcggagggtcaccggatcctcaaactgaacatc
ggaaacccggcaccttttggttttgaagcgccggacgccattttggtggacatgatccgc
cacctgccgaacgcccaaggctacagcgattcccgtggaatcttttctgccaggaccgcc
gtttcgcagtactaccagacgcgcggcatccagaacatccacgttgacgacatctacctc
ggcaacggtgtcagtgagctcatcaccatgtccctcatggcacttctggacgacggtgac
gaagtgctgattcccacgccggactacccgctgtggacggcttccgtcgcgctggccggt
ggccgtcccgtgcactacctctgcgacgaagagtccggatggcagcccgatcttgaggac
atggaagccaagatcacgccgcggaccaagggcattgtggtgatcaaccccaacaacccc
accggcgccgtctacccggaggagaccctcaagaagatcgtcgcgttggcagagaagcat
ggattggttcttttcgctgacgagatctacgagaaaatcctgtacgaagacgccgtccac
atcaacctcgcggggctcaccggtgatgacgtcctgtgcttgacgttcagcggcctgtcc
aaggcctaccgcgtctgtggctaccgcgccggctggatggcaatttccgggcccaagaag
gatgccgccgattaccttgagggcatcaacctgctggccaacatgcgcttgtgcgccaac
gtacctgcacagcacgccatccaaaccgcgctcggcggctaccagagcatcaacgatctc
atccttcccggcggcaggctcctggagcagcgcaacaaggcctacgacctcctgaacgcc
attcccggagtcagcacgcagcaggcgcgcggtgccctatacctgttcccgaagctggac
ccggaggtctatcacattcgggatgacgagaagttcgtcctggatctgctgaaggaacag
aaaatcctggtgtcccatgggcgtgcgttcaattgggttcgtccggaccacttccgaatg
gtcaccttgcccaatgtcaaggacatcgaagaagccatcggacgcatggcggacttcctg
tcgaggtacccgggcaactag

DBGET integrated database retrieval system