KEGG   Paenarthrobacter aurescens: AAur_3867Help
Entry
AAur_3867         CDS       T00447                                 

Definition
(GenBank) putative ATP dependent DNA ligase
Organism
aau  Paenarthrobacter aurescens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: ABM06459
UniProt: A1RBD2
LinkDB All DBs
Position
complement(4241184..4242248)
Genome map
AA seq 354 aa AA seqDB search
MDLPVMPPVSPMLAKSVPTIPDVGHYEPKWDGFRTIVFKDGDEIVLGSRNEKPMTRYFPE
VVEALRKNLPDKCVIDGEIVLIEGKRLEFEVLQQRIHPADSRVRMLAEKTPASMIAFDIL
ALGDENLMDKPFSERRAILERAFAKAEPPVYVTPAVTDLEQAQEWFVQLEGAGLDGVLSK
PLDGAYQPNKRVMFKTKHERTADCVVAGFRWHKTAKVVGSMLLGLHDDTGRLHHVGVVAS
FPMARREALVAELEPYQVELSEHPWGEWANQDETAGGSRMPGAQSRWSGGKDFSFVPLRP
ELVIEVKYDYMEGDRFRHTTQFRRWRPDRTPESCTYSQLEEPADYDLGEILRLP
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcctgtgatgccacccgtctcgcccatgctcgccaaatccgttccgacaatc
cccgatgttgggcactacgagcccaaatgggacgggttccggaccatcgtcttcaaggat
ggcgacgagatcgtcctgggcagccgcaacgagaagccgatgacccgctacttccccgag
gtggtggaggcgctcaggaagaacctgccggacaaatgcgtgatcgacggcgagatcgtc
ctgatcgagggcaagaggctcgaattcgaagtactccagcaaaggatccaccccgccgac
agccgcgtccggatgctcgccgagaagaccccggcgtccatgattgcgttcgacatcctc
gcgctgggcgacgagaacctcatggacaagccgttctccgagcgccgcgccatcttggaa
cgtgcgttcgccaaggccgagccgcctgtctacgtgacgcccgcggtgacggatcttgaa
caggcgcaggagtggttcgtgcagttggaaggcgcgggactggatggtgtgctctccaag
ccgttggacggggcctaccaacccaacaagcgcgtgatgttcaaaaccaaacacgagcgc
acggcagactgtgtggtggcgggattccgttggcacaagaccgcgaaagttgtggggtcg
atgttgctcggcctgcacgatgacactggccggctgcatcatgtgggagtggtggcatcg
ttccctatggcccgcagggaggctttggtggcagaactggagccgtaccaggttgaactc
agcgagcacccatggggtgagtgggccaaccaggatgaaactgccgggggttcacgcatg
cccggcgcacaaagccggtggagcgggggtaaggacttctccttcgtgccgctgcgcccc
gaacttgtgatcgaagtaaagtacgactacatggaaggtgacaggttccggcacaccaca
cagttccgcaggtggcggccggacaggacccccgagagctgcacgtactcgcaactggaa
gagcctgccgactacgatctcggggaaatcctgaggctgccctag

DBGET integrated database retrieval system