KEGG   Paenarthrobacter aurescens: AAur_3971Help
Entry
AAur_3971         CDS       T00447                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
aau  Paenarthrobacter aurescens
Pathway
aau00250  Alanine, aspartate and glutamate metabolism
aau00410  beta-Alanine metabolism
aau00430  Taurine and hypotaurine metabolism
aau00650  Butanoate metabolism
aau01100  Metabolic pathways
aau01110  Biosynthesis of secondary metabolites
aau01120  Microbial metabolism in diverse environments
aau02024  Quorum sensing
Module
aau_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:aau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AAur_3971
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AAur_3971
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AAur_3971
   00430 Taurine and hypotaurine metabolism
    AAur_3971
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AAur_3971
Enzymes [BR:aau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AAur_3971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ABM09145
UniProt: A1RBN1
LinkDB All DBs
Position
4341440..4342840
Genome map
AA seq 466 aa AA seqDB search
MSRSHRASQHEPDTAVELNPLFSRPGESTIFPRFTLPDGESLPATAYQVVHDEAMLDGNS
RLNLATFVGTWMETEASKLYAETFDKNMIDKDEYPQTALIETRCWRMLADLWNAPDPEKS
IGTSTIGSSEACMLGGLALKRRWQHARRAAGKSTEKPNLILSSAVQVCWEKFCNYWDVEP
RFVPVSAEHPTLDGHDLDQYVDENTIGVVAILGVTYTGKYEPVELISDALDEIQARHGLD
IPIHVDGASGAMVAPFLQPETVWDFRLPRVASINTSGHKYGLVYPGLGWVVWRDAAALPE
DLIFHVSYLGGDMPTFALNFSRPGAQVLLQYYLFLRLGFAGYRSVQATSRDVALYLSSEI
GAMDAFTLWSDGSDIPVFAWQLSDGHTEHWNLHHLSERLRMNGWLVPAYPLPDGLSDVTV
QRIVVRNGFTRDLASSFLADLKKEVDYLDSLTAPMPTDKQAEGFHH
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgagcagatcccaccgagcgtcacagcatgaaccggacaccgccgtcgaactcaatccc
ctgttcagcaggcccggagaatccaccatctttccccgtttcaccctgccggacggtgaa
tccttaccggccacggcctaccaggttgtgcacgatgaagcgatgctggacggcaactcg
cggctgaacctggccacgttcgttggaacgtggatggagacggaagcctccaagctctac
gccgagacgttcgacaagaacatgatcgacaaggacgagtacccccaaacggctctgatc
gaaacccgttgctggcggatgctcgcggatctgtggaacgctccggatcccgagaagagc
atcggcacctccaccatcggatcgtcggaggcctgcatgctgggtggcttagccttgaag
cgacggtggcaacacgcaaggcgcgcagcgggcaagtccacggagaaacccaatctcatc
ctcagctccgccgttcaagtgtgctgggagaagttctgcaattactgggatgtggagccc
cgttttgtcccggtctcagccgagcaccccacgctggatggccatgacctggaccagtac
gtggacgaaaacaccatcggcgtggtcgccatcctgggtgtcacctacaccgggaagtat
gagcctgtggaactcatctcggacgcgttggacgagatccaggcccgccatggactggac
attcccatccacgtggacggggcttccggagccatggtggcaccgttcctgcaacctgaa
acggtgtgggatttccggctcccccgcgtcgcatcgatcaacacctccggccacaaatat
gggctggtgtatcccggactgggctgggtggtgtggcgggacgcggcggcgctccccgag
gaccttatcttccacgtcagctacctcggcggggacatgcccacatttgcgctgaacttt
tcacggcccggcgcccaagtgctgctgcagtattacctcttcctgcgccttggctttgcc
gggtacaggtccgtccaagcgacgtcacgggacgtggcgctttacctctccagcgagatc
ggggccatggacgcgttcaccctgtggagcgacggctcggacattccggtattcgcgtgg
cagctcagcgacggccacacggaacactggaacctgcaccatctctcggaacggctcaga
atgaacggctggctggttccggcgtaccccctccctgacgggttgagtgacgtcacggtc
cagaggatcgtggtccgcaacggtttcacccgcgacctcgcctccagtttcctggctgac
ctcaagaaggaagtggactacctcgacagtctcacggcaccgatgcccaccgacaagcag
gcagagggctttcaccactaa

DBGET integrated database retrieval system