KEGG   Alteromonas australica DE170: EP12_02170Help
Entry
EP12_02170        CDS       T03858                                 

Definition
(GenBank) penicillin-binding protein
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
aaus  Alteromonas australica DE170
Pathway
aaus00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:aaus00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EP12_02170
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:aaus01003]
    EP12_02170
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aaus01011]
    EP12_02170
Enzymes [BR:aaus01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     EP12_02170
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     EP12_02170
Glycosyltransferases [BR:aaus01003]
 Polysaccharide
  Bacterial polysaccharide
   EP12_02170
Peptidoglycan biosynthesis and degradation proteins [BR:aaus01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   EP12_02170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase UB2H UvrB_inter
Motif
Other DBs
NCBI-ProteinID: AJP42685
LinkDB All DBs
Position
491094..493415
Genome map
AA seq 773 aa AA seqDB search
MAKKQSNPKKKSSFLFKLFWRLFFVGLVVLGAYAFYLDAQIKHEFSGNKWEVPAQIFARP
LRLSKGEEITVQEVLDELSLLGYRKVTDADSSGEYSYRNGVLTVQRRAFHFPEGAEPQRH
LVISWQGGRIKEIQDVSQGRAFGSVKLEPWLVTRMVSGSHEDRMLVSIDTTPDMLPKALT
LVEDRNFYNHHGVAPLSILRALMANIAAGRTVQGGSTLTQQLVKNMFLTRERSIVRKAKE
AIMAVIIDACYSKSEILEAYLNEVFLGQNGDMAVHGFGLASYFYFDRPANELSVPEIATL
VAMIKGPSYYNPRRYPERVKERRDLVLRMLFDENEIDRSQYERYVSMPLGLASGASLASG
KHPAFMEQVRRELNEILAEPSLRDSGVKVFTTLDIVAQRRAEKALSSTLNALQKNRTVPL
EGAMIVTDSAKGEVRAIVGGKDVSFKGFNRALDAKRPIGSLVKPAVYLTALEDPTEFNLA
TPLADEPITLESKGGKTWSPQNYDKTFRGQVSLLQGLTESLNIPTVNLGMQVGLDAVVNT
LEKLGVGAAIEQVPSLTLGAFELTPFNTNQMYQTLSNGGRYIPLHTVSAVVTADNGLLWQ
KAEFFSQRTDEAATYLLNYALYKVTTQGTAKRVGATFGTTNMAGKTGTTDDYRDSWFSGF
DRNNVVTVWVGNDDNQPVGLTGASGALPVFVNYMKSQAPKSLSRRFPEGLGIAHFDAKTG
AVVVAGCAGSLSVPAILDVLPPPQQDCAGKPVRSKQEQEKGDKKSWWERWFGE
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaaaagcaaagtaatcccaaaaagaagtcttctttcttatttaaattattctgg
cgacttttcttcgttggtttagtggtgctaggtgcttatgccttttatcttgatgcgcaa
ataaagcacgaattttcgggcaacaagtgggaagtgcccgcgcagatttttgcccgccca
ttacgacttagcaaaggggaagaaatcaccgttcaagaagtcctcgatgagctatcttta
ctcggttatcgaaaggtgactgatgcagacagtagtggtgaatacagttaccgaaatggt
gttttaaccgttcagcgacgggcgtttcacttcccagaaggcgctgagccacagcgacat
ttagtgatcagttggcaaggtggcagaattaaagagatacaagatgttagtcagggacgc
gctttcggctcagtgaaattagaaccttggcttgtgactcgcatggtgagcggtagccac
gaagaccgcatgctagtgagtatagataccacgcctgacatgctaccaaaggcactgaca
ctagttgaagatagaaatttttataatcaccacggggtagcgcccttatctattcttcgt
gcattaatggcaaatatagcggcagggcgaaccgttcaggggggaagtacgcttacccaa
caattggttaagaacatgttcttaacccgcgaacgctctatcgtacgcaaagcaaaagaa
gccattatggcggtaattattgatgcgtgttacagtaaatcggaaatattggaagcctac
ttaaatgaagtgtttttagggcaaaatggcgatatggccgtgcacggattcggccttgcc
agctatttctattttgaccgccccgccaatgaattaagtgtacctgagattgccaccttg
gtcgctatgatcaaaggcccatcctattacaacccaaggcgttaccccgagcgcgttaaa
gaacgtagagatttagtcttacgcatgttgtttgacgaaaacgaaattgatcgctctcag
tatgaacggtatgtatctatgcctttagggttagcatcgggtgccagtttagccagcggt
aaacaccccgcattcatggagcaggtaaggcgtgaattaaatgaaatattagccgaaccg
agcttacgtgattcaggggtaaaggtttttacaacccttgatattgtggcgcagcgcaga
gcagaaaaagcactttcaagcacgttaaatgcgctgcaaaaaaatcgaaccgtgccatta
gaaggcgcgatgatagtcactgacagtgcaaagggtgaagtccgcgcgattgtggggggt
aaagacgtgtcatttaaaggctttaaccgtgcacttgacgccaaaagacccataggctcc
ttggtgaaacctgcggtctatttgaccgcgctcgaggatcctaccgagtttaacttggcc
acgcctttagctgatgaacctattaccttggaaagcaaaggggggaaaacctggtcacca
caaaactatgacaaaacgttcagaggccaagtgtctttgctacaaggactcacggaatct
ctcaatatccctactgttaacttaggcatgcaggtgggtttagatgcggtagtgaatacg
ctagaaaagttaggggtaggggcagctattgaacaagtgccatcgctcacgttaggcgct
tttgagcttacgccttttaatactaaccaaatgtatcaaaccttatcaaatggggggcgc
tacatcccactgcacacagtgtcagcggtggtaacggcagacaatggcttattatggcaa
aaggcagaattcttctcacaacgtaccgatgaagctgccacttatttgttgaattacgcg
ctctataaagtcaccacgcagggtacagcgaaacgtgttggcgccacctttggcaccaca
aatatggcgggtaaaacaggcacaactgacgattatcgtgatagttggtttagcgggttc
gatcgcaacaatgtggtgactgtatgggtggggaatgacgacaaccaacctgtgggatta
accggtgcatcaggtgcattacctgtgttcgttaactatatgaaatcccaagcgcctaaa
tccttatctaggcgttttccggaagggcttggcattgcgcattttgatgcgaagactggc
gctgtggtggtggcaggctgtgcgggaagcttaagtgtgccagccatacttgatgtgctt
cctccgccgcaacaagattgcgcgggcaaacctgttcgcagtaaacaagagcaggaaaaa
ggcgataaaaagagctggtgggaacgttggtttggagaataa

DBGET integrated database retrieval system