KEGG   Alteromonas australica DE170: EP12_04880Help
Entry
EP12_04880        CDS       T03858                                 

Definition
(GenBank) 3-hydroxyacyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
aaus  Alteromonas australica DE170
Pathway
aaus00061  Fatty acid biosynthesis
aaus00780  Biotin metabolism
aaus01100  Metabolic pathways
aaus01212  Fatty acid metabolism
Module
aaus_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:aaus00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    EP12_04880
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    EP12_04880
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:aaus01004]
    EP12_04880
Enzymes [BR:aaus01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     EP12_04880
Lipid biosynthesis proteins [BR:aaus01004]
 Fatty acid synthase
  Component type
   EP12_04880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT
Motif
Other DBs
NCBI-ProteinID: AJP43135
UniProt: A0A075P450
LinkDB All DBs
Position
1074885..1075334
Genome map
AA seq 149 aa AA seqDB search
MANSLNTIEIQEIMSLLPHRYPFLLVDRVTDYVLGESIKAYKNITINEPCFTGHFPEQPI
FPGVLILEAMAQAAGILGFKTMGNNDQLYLYAGIDNARFKRPVVPGDKLEFDICLLKERR
GIWKFKGTATVNNELACSAEFMCAMREIA
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
ttggccaattcactcaataccattgaaattcaggaaatcatgtcgctgttaccacacaga
tatcctttcctgttggttgatcgagttacagattatgttctgggtgaatcaatcaaagcg
tataaaaatatcaccatcaatgaaccttgctttacggggcatttccctgagcagccaatt
tttcctggcgtgcttattttagaggctatggcacaggcggcaggtattcttggttttaaa
accatggggaataatgatcagttatacttatacgcaggaatcgataacgctaggttcaag
cgccctgtggtacccggtgataaactggagtttgatatttgcttattgaaagagcgcaga
gggatttggaaatttaaaggaactgcaaccgtgaataacgaattagcgtgcagtgcagag
tttatgtgtgcaatgagagagatagcataa

DBGET integrated database retrieval system