KEGG   Alteromonas australica DE170: EP12_08945Help
Entry
EP12_08945        CDS       T03858                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
aaus  Alteromonas australica DE170
Brite
KEGG Orthology (KO) [BR:aaus00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EP12_08945
Enzymes [BR:aaus01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     EP12_08945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 HI0933_like FAD_binding_2 GIDA FAD_oxidored DAO Thi4 AlaDh_PNT_C Lycopene_cycl NAD_binding_7 NAD_binding_8 K_oxygenase Glutaredoxin 3HCDH_N FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AJP43767
UniProt: A0A075NYY5
LinkDB All DBs
Position
1930016..1931605
Genome map
AA seq 529 aa AA seqDB search
MLTKEILQALKGYTESMQKNVTFVVQTGEHSKRAELVSFLSDIAGVSDKLNVEERDTQGQ
LRSAISFLLEADGQDTGIRFSGIPGGHEFNSLILAILHASGTELKVDDSVKSIVKAVKDE
LNFEVFISLSCHNCPEVVQALNQFALLNDNITSEMIDGGLYQNLISERDIQGVPSVYLNG
ELFANGKVDAASLIDKLIERDPSLKEANTGVQLPLQDVTVIGGGPAGVASAIYSARKGLK
VTVVAESFGGQVKDTMGIENLISVPKTTGPELVGNLMEHVNDYDITLKEHVRVENIEKGN
VKTITLSSGEQIRTRSLVVATGARWRELGVPGERENVGNGVAYCPHCDGPFFKGKDVAVI
GGGNSGIEAALDLAGIVKSVTVFEFMPTLKADQVLIDQAEKRDNITIIKNAATRQILAEN
GKVNAIEYQDRSTNEVHTLDLAGVFVQIGLVPNSQFMKDVVEMTPYGEIVVDTKCQTSEA
GIFAAGDVTTVPYKQIVISMGEGAKASLAAFEYLLSHEVIESEDESAAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
gtgttaactaaagaaattttgcaagcattgaaaggttacaccgagtcaatgcaaaaaaac
gtaacctttgtcgtacagactggtgaacacagcaagcgtgctgagcttgtgtcgtttctg
tccgacattgcaggtgtaagcgataaattaaatgttgaagaacgtgatacgcaaggtcaa
ttgcgtagcgcaatcagtttcctacttgaagccgatggccaagatacggggattcgcttc
tcaggcattccaggcgggcatgagttcaactctctgatccttgctattcttcacgcctca
ggaactgaactgaaagtagacgacagcgttaaatctatagttaaagctgtaaaagacgaa
cttaactttgaagtgttcatcagccttagctgtcacaactgcccagaagttgtgcaggcg
cttaatcaattcgcgctattgaacgacaatattacgtctgaaatgattgacggtggttta
tatcaaaacctgatcagtgagcgagatattcaaggcgttccaagtgtttacctaaacggt
gagttatttgccaacggtaaagttgacgcagcctcacttatcgacaagcttattgagcgc
gatccgtcgttaaaagaagcgaatacaggcgtacaattaccacttcaagatgtcaccgtg
attggtggtggtcctgcaggcgtagcgtctgctatatacagtgctcgtaaaggcctgaaa
gttaccgtcgtggctgaaagctttggtggccaagtaaaagatactatgggtattgagaat
cttatctctgtaccaaaaaccacaggcccagagcttgttggtaatttgatggaacacgtt
aacgattacgacattacgcttaaagagcatgtgcgtgttgagaatatcgaaaaaggtaat
gtgaagaccatcacactgtcttcgggtgaacaaattcgtacacgttcactggtggttgcc
actggtgctcgctggagagagttgggcgtgcccggtgagagagagaatgttggtaatggt
gttgcgtattgtccgcactgtgatggtccattctttaaaggtaaagatgtggctgttatt
ggcggcggtaactcaggtattgaagctgcactagatttggcaggcattgtaaaatcggta
accgtatttgaatttatgcctacgcttaaggccgatcaggtactgatcgaccaagctgaa
aagcgtgacaatattacgattattaagaatgccgctacccgtcagattttggctgaaaac
ggtaaagtcaatgccattgaatatcaagatagaagtactaatgaagtgcatactcttgac
ttagcaggtgtattcgtccaaatcgggttggtgcctaatagccaattcatgaaagatgtg
gtggaaatgacaccgtatggcgagattgttgtagatactaagtgtcaaacctctgaagca
ggcatttttgctgcaggtgacgtgacaactgtaccctacaagcaaatcgttatttcaatg
ggcgagggcgcaaaagcttctcttgcagcatttgaatacttactcagtcacgaagttatt
gagtctgaagacgaaagtgctgctgcataa

DBGET integrated database retrieval system