KEGG   Alteromonas australica DE170: EP12_09720Help
Entry
EP12_09720        CDS       T03858                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
aaus  Alteromonas australica DE170
Pathway
aaus00020  Citrate cycle (TCA cycle)
aaus00190  Oxidative phosphorylation
aaus00650  Butanoate metabolism
aaus01100  Metabolic pathways
aaus01110  Biosynthesis of secondary metabolites
aaus01120  Microbial metabolism in diverse environments
aaus01130  Biosynthesis of antibiotics
aaus01200  Carbon metabolism
Module
aaus_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aaus_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
aaus_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:aaus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EP12_09720 (sdhA)
   00650 Butanoate metabolism
    EP12_09720 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    EP12_09720 (sdhA)
Enzymes [BR:aaus01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     EP12_09720 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     EP12_09720 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like DAO Thi4 FAD_binding_3 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AJP43899
UniProt: A0A075P6H6
LinkDB All DBs
Position
2100870..2102642
Genome map
AA seq 590 aa AA seqDB search
MSLPVHEFDAVVIGAGGAGMRAALQISQSGKSCALLSKVFPTRSHTVSAQGGITVALGNS
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAIIEMENMGLPFSRFENGKIYQRPFG
GQSKNFGGEQGARTAAAADRTGHALLHLLYQQNVKNKTKVFSEWYALDLVKNQDGDVVGC
TAIDIETGEVVYFKSRAVVLATGGAGRIYASTTNAHINTGDGVGMALRAGVAVQDMEMWQ
FHPTGIAGAGTLVTEGCRGEGGYLLNKDGERFMERYAPNAKDLAGRDVVARSMMTEIREG
RGCEGPWGTHLKLKLDHLGKDVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGI
PTTVDGQCLTVDADGNDKVVNGLFACGEIACVSVHGANRLGGNSLLDLVVFGRATGLHLG
TTLSEMAPTRDASESDLDASMTRFNRWENSEKGKGEDPVQIKKDLQQCMQLNFSVFREGD
AMAEGLRELSEIRERLKHARLDDKSSDFNTQRIECLELDNLMETAYSTAVAANFRTESRG
AHSRFDFPDRDDENWLCHSIYDPNTDKMLTRDVNMAPKLREAFPPKVRSY
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgagtttacccgttcacgagtttgatgcagtagtaattggagctggtggcgcaggcatg
cgtgcagcactacagatttcgcaatctggtaaatcatgtgcactgttatcaaaagttttt
ccaacccgttctcatactgtgtctgcacagggtggtattaccgtcgcattaggtaattca
cacgaagacaattgggaatggcacatgtacgacaccgttaaaggttctgattatatcggt
gaccaagacgcgattgaatacatgtgtaaaactggcccagaagcgattatcgaaatggag
aacatgggtttacccttctcacgtttcgaaaacggtaaaatttaccagcgtccttttggt
ggtcagtctaagaattttggtggagagcagggcgcccgaactgcggcagccgctgaccgt
acaggtcatgcacttcttcaccttctttaccaacaaaacgtaaagaacaaaacaaaggta
ttttctgaatggtatgccctcgaccttgttaaaaaccaagatggcgatgtcgttggttgt
actgctatcgatatcgagacaggtgaagtggtttacttcaaatcacgcgctgttgtgtta
gcaacaggtggtgcaggtcgtatctatgcgtctaccactaatgcacacattaataccggt
gacggtgtgggcatggcacttcgtgctggtgttgctgttcaagatatggaaatgtggcaa
ttccacccaacaggtattgctggcgcagggacattggtaacagaaggttgtcgtggtgaa
ggtggttaccttcttaacaaagacggcgaacgcttcatggagcgctatgcgccaaacgcg
aaagacttagcgggtcgtgacgttgttgctcgttcaatgatgactgaaatccgcgaaggt
cgtgggtgtgaaggcccatggggaactcaccttaagcttaagttggatcacttaggtaaa
gacgtacttgagtcacgcttacctggtattcttgagctatcgcgtacgtttgcccacgtc
gacccggtcaaagaacctattccggttattccaacttgtcactatatgatgggtggtatt
ccaactaccgttgatggtcagtgtttaactgttgatgccgacggtaatgacaaagttgtt
aacggtttattcgcttgtggtgagattgcatgtgtatctgttcatggtgcaaaccgcctt
ggtggtaactctctattagaccttgttgtattcggtcgtgcgactggtttacaccttggt
actacgctttcagaaatggcaccaacacgtgatgcttctgagtcagatttagacgcatct
atgacgcgcttcaatcgttgggaaaattctgagaaaggcaagggcgaagatcctgttcaa
attaagaaagacttgcagcaatgcatgcagcttaacttctcagtattccgtgagggtgac
gccatggcagaagggcttagagagcttagcgaaattcgcgagcgtcttaagcatgcgcgc
cttgacgacaagagttcagactttaacactcagcgtatagagtgtcttgaactagataac
cttatggaaaccgcgtacagcacagcagtagcagcgaacttcagaacggaaagccgtggc
gctcacagccgcttcgacttcccagatcgtgatgatgaaaactggttatgccacagtatt
tacgatccgaacactgataaaatgctcacacgtgatgtcaatatggcgcctaagcttagg
gaagcattcccgcctaaagtgcgttcatattaa

DBGET integrated database retrieval system