KEGG   Alteromonas australica DE170: EP12_09725Help
Entry
EP12_09725        CDS       T03858                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
aaus  Alteromonas australica DE170
Pathway
aaus00020  Citrate cycle (TCA cycle)
aaus00190  Oxidative phosphorylation
aaus00650  Butanoate metabolism
aaus01100  Metabolic pathways
aaus01110  Biosynthesis of secondary metabolites
aaus01120  Microbial metabolism in diverse environments
aaus01130  Biosynthesis of antibiotics
aaus01200  Carbon metabolism
Module
aaus_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aaus_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
aaus_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:aaus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EP12_09725 (sdhB)
   00650 Butanoate metabolism
    EP12_09725 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    EP12_09725 (sdhB)
Enzymes [BR:aaus01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     EP12_09725 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     EP12_09725 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_18 Fer4_9 Fer4 Fer4_6
Motif
Other DBs
NCBI-ProteinID: AJP43900
UniProt: A0A075NZE9
LinkDB All DBs
Position
2102657..2103367
Genome map
AA seq 236 aa AA seqDB search
MQKTFSIYRYNPEVDAKPRMQDYTLEVEEGQDMMVLDALLALKEQDPTLSFRRSCREGVC
GSDGVNMNGKNGLACITPLSALGNGKVVVRPLPGLPVVRDLVVDMTQFYTQYEKIKPFLI
NDQKQPPAREHLQSPEERAKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLHAYRFL
IDSRDTATDERLNDLDDAFSVFRCHGIMNCVSVCPKGLNPTKAIGHIKSMLLQRAV
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaactttttcgatttatcgttataacccagaagtagacgctaagcctcgcatg
caagactacactctagaagtagaggaaggtcaggacatgatggtgctcgacgcactatta
gcacttaaagagcaggatccgacgctttcattccgtcgttcttgccgtgaaggtgtatgt
ggttcagatggtgtaaacatgaacggcaaaaacggcctagcatgtatcacaccattatcg
gcattgggtaatggtaaggttgtggttcgtccattaccgggtttacctgtagtacgtgac
cttgtcgtagacatgacacagttctacactcaatacgaaaagattaagccattcttaatc
aacgaccaaaaacagccgcctgcacgagaacatcttcagtctcctgaagaacgtgctaag
cttgatggactgtacgagtgtattctttgtgcatgttgttctacgtcgtgcccgtctttc
tggtggaaccctgataaattcattggtcctgctggtttgcttcacgcttatcgattctta
attgatagccgagatacggccactgatgaacgtcttaacgaccttgatgacgcattcagc
gtattccgctgccacggcatcatgaactgtgtaagcgtatgcccgaaaggattgaacccg
acaaaagcaattggacatattaagtctatgcttttacaacgggctgtttag

DBGET integrated database retrieval system