KEGG   Acidovorax citrulli: Aave_0048Help
Entry
Aave_0048         CDS       T00451                                 

Definition
(GenBank) glutathione S-transferase, C-terminal domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
aav  Acidovorax citrulli
Pathway
aav00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:aav00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Aave_0048
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aav02000]
    Aave_0048
Enzymes [BR:aav01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Aave_0048
Transporters [BR:aav02000]
 Other Transporters
  Pores ion channels [TC:1]
   Aave_0048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_N_3 GST_N GST_N_2 GST_C_2 2Fe-2S_Ferredox
Motif
Other DBs
NCBI-ProteinID: ABM30663
UniProt: A1TI75
LinkDB All DBs
Position
complement(54822..55430)
Genome map
AA seq 202 aa AA seqDB search
MKLYYSPGACSLSPHIALHEAGLAFTPVLASTKSHKLQDGTDFYTINPLGYVPVLELDDG
TRLREGPAIVQYIADQAPHKNLAPANGTLARYRLQEWLNFIGTELHKGHSPLFQPNTPDA
YKPIVREKLMSRFQWVDEQLSGREWLTGEHFSVADGYLFTVSGWGKHVGVDLSGLPNLQA
YLARVGSRPAVQAALKAEGLQK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctactacagtcctggtgcctgctcgctttccccgcacatcgccctgcacgag
gccggcctggccttcacccccgtgctcgcgagcaccaagagccacaagctccaggacggg
accgacttctataccatcaaccccctcggctatgtgccggtgctggaactcgacgacggc
acccgcctgcgcgaaggccccgccatcgtgcaatacatcgccgaccaggcgccccacaag
aacctggcgccggccaacggcacgctggcgcgctatcgcctgcaggaatggctgaacttc
atcggcacggaactgcacaagggccacagcccgctgttccagcccaacacgcccgatgcg
tacaaacccatcgtgcgcgagaagctgatgtcgcgcttccagtgggtggacgaacagctc
tccggcagggaatggctgacgggcgagcacttctccgtggcggacggctacctgttcacc
gtcagcggctggggcaagcacgtgggcgtggacctgtccggcctgccgaacctgcaggcc
tatctggcacgcgtgggctcccgcccggccgtgcaggccgccctcaaggcagagggcctg
cagaagtaa

DBGET integrated database retrieval system