KEGG   Acidovorax citrulli: Aave_0253Help
Entry
Aave_0253         CDS       T00451                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
aav  Acidovorax citrulli
Pathway
aav00473  D-Alanine metabolism
aav01100  Metabolic pathways
aav01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:aav00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Aave_0253
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Aave_0253
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aav01011]
    Aave_0253
Enzymes [BR:aav01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Aave_0253
Peptidoglycan biosynthesis and degradation proteins [BR:aav01011]
 Precursor biosynthesis
  Racemase
   Aave_0253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ABM30860
UniProt: A1TIS2
LinkDB All DBs
Position
282246..283355
Genome map
AA seq 369 aa AA seqDB search
MPRPIQATIHTAALQQNLARARAAAPDARVWAVVKANAYGHGIERAFEGLRGADGFALLD
LGEAERVRQLGWRGPILLLEGVFEPRDLELCSRLSLWHAVHCDEQIDWLSAHKTHAPHRV
FLKMNSGMNRLGFPPARYRAAWARLNALPQVDEISFMTHFSDADGPRGIAHQIDAFCTAT
QDLPGERTVSNSAATLRHAGGDARVRGDWVRAGIVLYGSAADHPEHTAAHWGLAPTMTLS
ARIIGTQQLQAGDTVGYGSSFTADRPMTIGVVACGYADGYPRHAPTGTPVLVNGVRTRTV
GRVSMDMITVDLTPLHEAGVEAGVGSEATLWGRASCGAVLCIDEVAQAAGTVGYELMCAL
APRVPVVVD
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgccccatacaagccaccatccacactgctgcactgcagcaaaacctggcgcgt
gcccgtgccgctgcgcccgacgcccgcgtatgggccgtggtcaaggccaacgcctacggc
cacggcatcgagcgcgccttcgaggggctgcgcggcgcggacggcttcgcgctgctggat
ttgggcgaggcagagcgggtgcgccagctgggatggcgggggcccatcctgctgctggaa
ggggtgttcgagccgcgagacctcgagctgtgctcgcgcctgtcgctctggcacgcggtg
cactgcgacgagcagatcgactggctttccgcgcacaagacgcatgcgccgcaccgggtt
ttcctcaagatgaattcgggaatgaaccgcctgggcttccctcccgcgcgctaccgggcg
gcctgggcgcgcctgaatgcactgccgcaggtggacgagatctccttcatgacccacttc
agcgacgccgacgggccgcggggcatcgcccaccagatcgatgccttctgcactgccacg
caggacttgccgggcgagcgcacggtcagcaacagcgcggccaccctgcggcatgccggc
ggcgatgcgcgggtgcgcggcgactgggtgcgcgcgggcatcgtgctctacggcagtgcc
gccgaccaccccgagcacacggctgcgcactggggcctcgcacccaccatgacgctgtcg
gcgcgcatcatcggcacccagcagctgcaggccggggatacggtgggctacggctcgtcc
ttcaccgcggaccggccgatgaccatcggcgtggtggcctgcggctatgccgacggctac
ccgcgccatgcccccacgggcacgccggtgctggtgaacggcgtgcgcacccgcaccgtg
ggccgggtgagcatggacatgatcacggtggacctcacgccgctgcacgaggccggcgtg
gaggcgggcgtgggcagcgaggccaccctgtggggccgcgcgtcgtgcggggccgtgctg
tgcatcgacgaggtggcgcaggcggcgggcacggtgggctacgagctgatgtgcgccctg
gccccgcgcgtgccggtggtggtggactga

DBGET integrated database retrieval system