KEGG   Acidovorax citrulli: Aave_0291Help
Entry
Aave_0291         CDS       T00451                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
aav  Acidovorax citrulli
Pathway
aav00970  Aminoacyl-tRNA biosynthesis
aav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aav00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Aave_0291
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:aav03029]
    Aave_0291
Enzymes [BR:aav01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Aave_0291
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Aave_0291
Mitochondrial biogenesis [BR:aav03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Aave_0291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey RIIa DUF956
Motif
Other DBs
NCBI-ProteinID: ABM30898
UniProt: A1TIW0
LinkDB All DBs
Position
complement(322440..323894)
Genome map
AA seq 484 aa AA seqDB search
MTTSKLIHGYEVVIGFETHAQLATQSKIFSRAPTAFGAEPNTQACAVDLALPGTLPVMNR
EAVACAIRLGLALGSRVAPESIFARKNYFYPDLPKGYQISQFEIPVVQGGEVSFYLGDEK
KTVRLVRAHLEEDAGKSLHEDFIGQSGIDLNRAGTPLLEIVTEPDIRSSEEAVAYARELH
KIVTWIGICDGNMQEGSFRCDANVSVRRPGAPLGTRREIKNLNSFRFMQQAIDYEIRWQI
EQIEDGHAIQQATVLFDPDTGETRAMRTKEDAADYRYFPDPDLPPLRISEQWVQEERARM
PELPRTMAARFVADYGLPEYDATTLTQSKAMAAYFEEAARASGSPKLASNWIMGEVSRRV
NAGETDIAAAPVTAALLAKLIQRIADGTISNAAARQVFEALWTGEGTDVDAVIETRGLKQ
MNDSGALEKIIDEVIAANPDNVAQFKAGKGKAFNALVGQAMKASKGKANPQQVNEMLRAR
LAAA
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccagcaaactgatccatggctacgaagtcgtcatcggcttcgagacccacgcc
cagctcgccacgcaatcgaagatcttcagccgcgcgcccacggccttcggcgccgagccc
aacacccaggcctgcgccgtggacctggccctgcccggcacgctgcccgtgatgaaccgc
gaggccgtggcctgcgccatccgcctgggcctggccctgggctccagggtcgcgcccgag
agcatcttcgcgcgcaagaactacttctatcccgacctgcccaagggctaccagatcagc
cagttcgagatcccggtggtgcagggcggcgaggtgtcgttctatctcggcgacgagaag
aagaccgtgcgcctggtgcgcgcccacctggaggaagacgcgggcaagtcgctgcacgag
gatttcatcggccagtcgggcatcgacctgaaccgtgccggcacgccgctgctggagatc
gtgaccgagcccgacatccgcagcagcgaggaggccgtggcctatgcccgcgagctgcac
aagatcgtgacctggatcggcatctgcgacggcaacatgcaggaaggctccttccgctgc
gacgccaacgtctccgtgcgcaggccaggggcgccgctgggcacgcgccgcgagatcaag
aacctgaacagcttcaggttcatgcagcaggcgatcgactacgagatccgctggcagatc
gaacagatcgaggacggccacgcgatccagcaggccaccgtgctgttcgacccggacacg
ggcgagacgcgcgccatgcgcaccaaggaagacgcggccgactaccgctacttccccgac
ccggacctgccgccgctgcggatttcggagcagtgggtccaggaagagcgcgcgcgcatg
cccgaactaccgcgcaccatggccgcgcgcttcgtggccgactacggcctgccggaatac
gacgcgaccacgctcacgcagtccaaggccatggcggcctacttcgaggaggcggccagg
gccagcggcagccccaagctcgccagcaactggatcatgggcgaggtgtcgcgccgcgtg
aacgcgggcgagaccgacatcgccgccgcgccggtgacggccgcgctgctggcgaagctg
atccagcgcatcgccgacggcaccatctccaacgccgccgcccggcaggtgttcgaggcg
ctctggaccggcgaaggcactgacgtggacgcggtgatcgagaccaggggcctcaagcag
atgaacgactccggcgcgctggagaagatcatcgacgaggtgatcgccgccaatcccgac
aacgtggcgcagttcaaggccggcaagggcaaggcgttcaacgccctggtgggccaggcc
atgaaggccagcaagggcaaggcgaacccgcagcaggtcaacgagatgctgcgcgcgcgg
ctcgcggccgcctga

DBGET integrated database retrieval system