KEGG   Acidovorax citrulli: Aave_0531
Entry
Aave_0531         CDS       T00451                                 

Definition
(GenBank) conserved hypothetical protein
Organism
aav  Acidovorax citrulli
SSDB
Motif
Pfam: DivIC TolA_bind_tri TMV_coat CcmH TBCC_N
Other DBs
NCBI-ProteinID: ABM31136
UniProt: A1TJJ8
LinkDB
Position
complement(574726..575385)
AA seq 219 aa
MVISRPPAGRPRDRWALWACAIALMVVGGVTAYNTAQLSRMAQEAKQANVDAEMQSLASS
VAQLRGAFDAARRQPVPVSEAAFSTAQKALGDRLTALEHAREGMARAEDLAALSSRIDAL
QAVVAARKAAAAPRQARAAESAATRERAPSPLPFTVLGSEMRAGVPFLAVVPSGPGSDSQ
VRLLREGEQERGWRLEVIEPQAAMFSVGDQVRRLPLRAR
NT seq 660 nt   +upstreamnt  +downstreamnt
atggtgatctcgcgcccgcccgccggacgcccccgcgatcgttgggctctctgggcctgc
gccatcgccctgatggtcgtgggcggggtgaccgcttacaacacggctcagttgtcgcgc
atggcgcaggaagccaagcaggcgaatgtcgatgcggagatgcagagcctggcgagcagc
gtggcgcagttgcgcggagcattcgatgccgcgcgccgtcaaccggtgcccgtcagcgaa
gcagctttctccacggcgcagaaggcgctcggcgaccggctcacggcgctcgaacacgca
cgcgagggcatggctcgggccgaggatctggcggccctgtcgtcgcgcatcgacgcactg
caggccgtagtcgctgcccgcaaggcggccgcagcgccacgccaggcgcgcgcagcggag
tccgcggcgacccgcgagcgcgcgccctccccgctcccgttcaccgtgctcggcagcgag
atgcgggccggggtgcctttcctggcggtcgttccatccgggccggggtcggactcgcag
gttcggctgctccgcgagggcgagcaggagcgtgggtggcggctggaagtgatcgagccg
caagccgccatgttctcggtcggagaccaggtgcgccggctgccgctgcgtgcgcgctga

DBGET integrated database retrieval system