KEGG   Acidovorax citrulli: Aave_0610Help
Entry
Aave_0610         CDS       T00451                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
aav  Acidovorax citrulli
Pathway
aav00564  Glycerophospholipid metabolism
aav01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Aave_0610
Enzymes [BR:aav01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Aave_0610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 NAD_binding_8 HI0933_like GIDA Thi4 Pyr_redox_3 3HCDH_N Pyr_redox Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ABM31214
UniProt: A1TJS6
LinkDB All DBs
Position
667817..669439
Genome map
AA seq 540 aa AA seqDB search
MARLNGQFIAMTLPNTPLPTDRARLLAQLAEPRQYDLAVIGGGATGLGAALDAAARGFSV
VLVESHDFAKGTSSRATKLVHGGVRYLAQGNISLVREALHERTTLLGNAPHLAQPLPFVM
PSYRFWETPFYGMGLKAYDLLAGRAGLGTTEFLGREGTLRLLPTVRRDGLQGGVKYWDGQ
FDDARLALALARTAALRGALLVNYCPARELIHENGKVAGLRCEDAETGTPYTLRARCVVN
ATGVWVDGLRSQDAEALGRPARPIVAPSQGVHIVVDREFLPSDHAMMVPKTADGRVLFAV
PWLGKVILGTTDSPRQDLEREPRPFKEEAAFILSESARYLTRAPSAADVRSIWVGLRPLV
RPPDDEGGNTKSISREHTVLASPSGLVTVTGGKWTTYRAMAEDVLQKCFDAGLLPARAGG
ATQRLPVVGAPDGPVQHGMDEAQGPHSYGSEAVFLDNVPGAQHWLAPGLSEAMVRFAARH
EYARTVEDMLARRSRMLFLDAAQALRLAPQVAAILAEELGTDPGLAAFEALAAQYHTVPA
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
ttggcccggttgaatggacaattcatcgccatgactctcccgaacacgcccctgcccacc
gaccgcgcccgactgctggcgcagcttgccgaaccccgccagtacgacctggcggtcatc
gggggcggggcgacggggctgggcgcggcgctcgacgccgcggcgcgcggcttcagcgtc
gtcctggtcgagtcccacgatttcgcgaaaggcacgtcctcgcgcgccaccaagctcgtg
cacggcggtgtccgctacctcgcgcagggcaacatctcgctcgtgcgcgaggcactgcac
gagcgcaccacgctgctcggcaatgcgccgcacctggcgcagccgctgcccttcgtgatg
ccgtcctaccgtttctgggagacgcccttctacggcatgggcctcaaggcctacgacctg
ctggcgggccgcgccggcctgggtaccaccgaattcctgggccgggagggcacgctgcgc
cttctgcccaccgtgcgccgcgatggcctgcagggcggcgtcaagtattgggacggccag
ttcgacgacgcacggctcgccctggcgctcgcgcgcaccgcggcgctgcgcggcgcgctg
ctcgtcaactactgcccggcgcgcgagctcatccacgagaacggcaaggtcgcgggcctg
cgctgcgaggacgccgaaaccggcaccccatacaccctgcgggcgcgctgcgtcgtcaat
gccacgggggtctgggtggacggcctgcgcagccaggacgccgaagccctcggccggccc
gcgcggcccatcgtcgcgcccagccagggcgtgcacatcgtggtggaccgggagttcctt
ccctccgaccacgcgatgatggtgccgaagacggcagacggccgcgtcctcttcgccgtg
ccctggctcggcaaggtcatcctcggcaccaccgacagcccccgccaggatctggagcgc
gagccgcgcccgttcaaggaagaggccgccttcatcctgagcgaatcggcgcgctacctc
acccgcgcgccgtcggccgcggacgtgcgcagcatctgggtgggcctgcgcccgctggtg
cgcccgcccgacgacgaggggggcaacaccaagagcatcagccgcgagcacaccgtgctg
gcgagcccgagcggcctggtcacggtgaccggcggcaaatggaccacctaccgcgccatg
gcggaggacgtgttgcagaaatgcttcgatgccggcctgctgccggcccgtgccggcggg
gcgacccagcgcctgccggtggtgggcgcgccggacggcccggtgcagcacggcatggac
gaggcccagggcccgcattcctacggctcggaggcggtcttcctggacaatgtacccggc
gcgcaacactggctggcgccgggcctctccgaggccatggtccgcttcgccgcgcgccac
gagtacgcgcgcaccgtcgaggacatgctcgcgcgccgcagccgcatgctcttcctcgac
gccgcacaggccctgcgcctggccccgcaggtggccgccatcctcgccgaagagctgggc
accgacccgggcctggccgcgttcgaggcgctcgccgcgcagtaccacacggttcctgcg
taa

DBGET integrated database retrieval system