KEGG   Acidovorax citrulli: Aave_0823Help
Entry
Aave_0823         CDS       T00451                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
aav  Acidovorax citrulli
Pathway
aav00473  D-Alanine metabolism
aav00550  Peptidoglycan biosynthesis
aav01100  Metabolic pathways
aav01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:aav00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Aave_0823
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Aave_0823
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Aave_0823
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aav01011]
    Aave_0823
Enzymes [BR:aav01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Aave_0823
Peptidoglycan biosynthesis and degradation proteins [BR:aav01011]
 Precursor biosynthesis
  Amino acid ligase
   Aave_0823
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp ATP-grasp_4 ATPgrasp_ST TTL RimK GARS_A CPSase_L_D2 ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ABM31421
UniProt: A1TKD3
LinkDB All DBs
Position
891866..892870
Genome map
AA seq 334 aa AA seqDB search
MAAGLPETEIDVRALGKVAVLMGGDSAEREVSLMSGGGVLQALRARGVDAHAFDPSQSDL
SELKSHGYARCFIALHGRHGEDGTVQGALELLGIPYTGPGVMASAIAMDKIMTKRIWRFE
GLPTPDWRLVSSAAETAQALEDLGSPMIVKPSREGSTIGLTKVTSPGQCEQAYRLASRYD
PEVLCEQFIEGEETTCPVLGQGAGAHALPVIRIVAPEGNYDYQNKYFTDVTQYHCPCGLP
EQEEREIQRLVVEAFRTLQCRGWARADIMIRASDRKPFLLEINTSPGMTGHSLVPMSARA
MGVSYEELCLRILAGASLDARQGQVDAAGHPGAA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgggcttacctgaaaccgaaatcgacgtgcgggcgctgggcaaggtggccgtg
ctgatgggcggcgactccgccgagcgggaggtttcgctcatgtccggcggcggcgtgctg
caggcgctgcgtgcgcgcggcgtggacgcgcatgccttcgatccgtcccagtccgacctg
tcggagctcaagagccacggctacgcgcgctgcttcatcgcactgcacggccggcatggc
gaggacggcaccgtgcagggcgcgctggagttgctgggcattccctataccggaccgggc
gtgatggcgtcggccatcgccatggacaagatcatgaccaagcgcatctggcgcttcgag
ggcctgcccacgccggactggcggctggtgtcgagtgctgccgagaccgcgcaggcgctg
gaggacctgggctcgcccatgatcgtcaagccctcgcgcgaaggctccaccatcggactg
accaaggtcacctcgcccggacagtgcgagcaggcctaccgcctggcctcgcgctacgac
cccgaggtgctgtgcgagcaattcatcgagggcgaggaaaccacctgccccgtgctgggc
cagggcgcgggcgcgcatgcgctgccggtgatccgtatcgtggcgcccgagggcaactac
gactaccagaacaagtacttcaccgacgtcacgcagtaccactgcccctgcggcctgccc
gagcaggaggagcgcgagatccagcgcctggtggtggaggcgttccgcacgctgcagtgc
cgcggctgggcccgcgccgacatcatgatccgcgcgagcgaccgcaagcccttcctgctg
gagatcaacacctcccccggcatgaccggccattcgctggtacccatgtcggcgcgcgcc
atgggcgtgagctacgaggaactgtgcctgcgcatcctggcgggggcgtcgctcgacgcg
cgccagggccaggtggacgccgcagggcatccgggagccgcatga

DBGET integrated database retrieval system