KEGG   Acidovorax citrulli: Aave_2000Help
Entry
Aave_2000         CDS       T00451                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
aav  Acidovorax citrulli
Pathway
aav00620  Pyruvate metabolism
aav00680  Methane metabolism
aav01100  Metabolic pathways
aav01120  Microbial metabolism in diverse environments
aav01200  Carbon metabolism
Module
aav_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:aav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Aave_2000
  09102 Energy metabolism
   00680 Methane metabolism
    Aave_2000
Enzymes [BR:aav01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Aave_2000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PRP38
Motif
Other DBs
NCBI-ProteinID: ABM32584
UniProt: A1TNP6
LinkDB All DBs
Position
2172455..2175310
Genome map
AA seq 951 aa AA seqDB search
MNATPSRKTDTAPEPQASPSPGRRADKDQPLIQDIRLLGRILGDVIREQEGVAAYDLVEQ
VRKLSVAFRRDADQEADKALKKLLKGLSGDQTVSVIRAFTYFSHLANLAEDRHHIRRRTV
HERAGSTQEGSIEVALARLRWAGIAPRAVAQTLARSYVSPVLTAHPTEVQRKSILDAERD
IAELLAERDEIQARGLFYKSARDALTPRELAANEARLRARVAQLWQTRLLRYSKLTVADE
IENALSYYESTFLREIPRLYEDLERALGSQPVASFLRMGQWIGGDRDGNPNVSADTLALA
LRRQAEVALRHYLTEVHYLGGELSLSARLVQVSPEMQQLAERSPDTSEHRQDEPYRRALT
GIYARLAATLRELTGGEAARHAVAPQNPYGDASEFLADLRVIEASLRSHRGAPLAAQRLH
PLVRAVEVFGFHLATVDLRQSSDQHERVVAELLATARIEADYAALPEDARQALLVRLLCD
ARPLRVVGAEYSEHTRGEIAIFETARRMRDRYGAQAIRHYIISHTETVSDLLEVLLLQKE
VGLMHGTLDGADARADLIVVPLFETIGDLRNAQPIMRALYEVPGFAAMVQRGGAEQDIML
GYSDSNKDGGIFTSNWELYRAEIALVELFDALEARHRIRLRLFHGRGGTVGRGGGPSYQA
ILAQPPGTVRGQIRLTEQGEVIASKYANPEIGRRNLETLVAATLEATLLQPTKPATKAFH
EAAAELSQASMAAYRALVYETPGFADYFFNSTPIREIAELNIGSRPASRKPSQKIEDLRA
IPWGFSWGQCRLTLPGWYGFGSAVEAFVKAAGEDPKARMALLQKMYRQWPFFRTLLSNMD
MVLAKSDLALASRYSELVADARLRRKVFGAIEAEWQRTVDALARITGDRQRLAHNTALAR
SIRHRFPYIDPLHHLQVELVRRWRAGEGSERVQTGIHICINGIAAGLRNTG
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcgacgccttcccgcaagaccgacaccgcgcccgaaccccaggcctcgccgtcg
cccggacgccgcgccgacaaggaccagccgctgatccaggacatccgcctgctcgggcgc
atcctgggcgacgtgatccgcgagcaggagggcgtggccgcctacgacctcgtggaacag
gtgcgcaagctgtcggtggcgttccgccgcgatgcggaccaggaggcggacaaggcgctc
aagaagctgctcaagggcctgtcgggcgaccagacggtgagcgtgatccgcgccttcacg
tatttcagccacctggcgaacctcgccgaggaccggcaccacatccgccgccgcaccgtg
cacgagcgcgccggcagcacgcaggaaggcagcatcgaggtggccctggcccggctgcgc
tgggcgggcatcgcgccgcgcgccgtggcgcagacgctggcacgcagctacgtgtcgccg
gtgctgaccgcgcacccgacggaggtgcagcgcaagagcatcctggacgcggagcgcgac
atcgccgaactgctggccgagcgcgacgagatccaggcgcgggggctgttctacaagtcc
gcgcgcgatgcgctcacgccgcgcgagctggcggccaacgaggcgcggctgcgcgcccgc
gtcgcgcaactgtggcagacccggttgctgcgctattcgaagctcacggtggccgacgag
atcgagaacgcgctctcctattacgaatcgaccttcctgcgcgagatcccgcgcctgtac
gaggacctggagcgggcgctgggcagccagccggtggcgagcttcctgcgcatgggccag
tggatcggcggcgaccgcgacggcaatcccaacgtgagcgccgacacgctggcgctcgca
ctgcgccgccaggccgaggtggcgctgcgccactacctgaccgaggtgcactacctgggc
ggcgagctgtcgctgtcggcccggctcgtgcaggtctctccggagatgcaacagttggcc
gaacgctcgcccgacaccagcgagcaccgccaggacgagccctaccgccgcgcgctcacc
ggcatctatgcgcggctggcggcgacgctgcgcgaattgacgggcggcgaggcggcgcgc
catgccgtggcgccccagaacccgtacggcgacgcttcggagttcctggcggacctgcgc
gtcatcgaggcctcgctgcggtcgcaccgcggggcgccgctggcggcgcagcggctgcat
ccgctggtgcgggccgtggaggtgttcggcttccacctggccacggtggacctgcggcag
agctccgaccagcacgagcgcgtggtggcggagctgctggccacggcccggatcgaggct
gattacgcggccctgccggaagatgcgcgccaggccctgctggtgcgcctgctgtgcgac
gcccggccgctgcgcgtggtgggcgcggaatactcggagcacacgcgcggcgagatcgcc
atcttcgagacggcgcggcgcatgcgcgaccgctacggcgcccaggccatccggcactac
atcatcagccacaccgagacggtgagcgacctgctggaagtgctgctgctgcagaaggaa
gtgggcctgatgcacggcacgctggacggggccgatgcccgcgccgacctgatcgtggtg
ccgctcttcgagaccatcggcgacctgcgcaacgcccagcccatcatgcgcgcgctctac
gaggtgccgggcttcgcggcgatggtgcagcgcggcggggccgagcaggacatcatgctg
ggctactcggacagcaacaaggacggcggcatcttcaccagcaactgggagctgtaccgc
gccgagatcgcgctggtggagctgttcgacgcgctggaggcgcggcaccgcatccgcctg
cggctcttccacggccgcggcggcacggtggggcgcggcggcggcccgagctaccaggcc
atcctggcgcagccgcccggcacggtgcgcgggcagatccgcctgaccgagcagggcgag
gtgatcgcctccaaatatgccaacccggagatcggccggcgcaacctggagacgctggtg
gcggccacgctggaggccacgctgctgcagcccaccaagcctgccaccaaggccttccac
gaggccgcggccgaactctcgcaggcgagcatggcggcctaccgcgcgctggtgtacgag
acgccgggcttcgccgactatttcttcaactccacgccgatccgggagatcgccgagctc
aacatcggctcgcgcccggcctcgcgcaagccgagccagaagatcgaggacctgcgcgcc
atcccctgggggttcagctggggccagtgccggctcacgctgccgggctggtacggcttc
ggatcggccgtggaggccttcgtgaaggccgcgggcgaggatcccaaggcccgcatggcg
ctgctgcagaagatgtaccggcagtggccgttcttccgcacgctgctgtccaacatggac
atggtgctggccaagagcgatctggccctggcgtcgcgctacagcgaactggtggcggac
gcgcgcctgcggcgcaaggtgttcggtgccatcgaggccgaatggcagcgcacggtggat
gcgctggcgcgcatcaccggcgaccggcagcggctggcccacaacacggccctggcgcgc
tcgatccgccaccgtttcccctacatcgatccgctgcaccacctgcaggtggaactggtg
cggcgctggcgcgcgggcgagggcagcgagcgcgtgcagaccggtatccacatctgcatc
aacggcatagcggcgggtctgcgcaataccggctga

DBGET integrated database retrieval system