KEGG   Acidovorax citrulli: Aave_2051Help
Entry
Aave_2051         CDS       T00451                                 

Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
aav  Acidovorax citrulli
Pathway
aav00061  Fatty acid biosynthesis
aav00780  Biotin metabolism
aav01100  Metabolic pathways
aav01130  Biosynthesis of antibiotics
aav01212  Fatty acid metabolism
Module
aav_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:aav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Aave_2051
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Aave_2051
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Aave_2051
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:aav01004]
    Aave_2051
Enzymes [BR:aav01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Aave_2051
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Aave_2051
Lipid biosynthesis proteins [BR:aav01004]
 Fatty acid synthase
  Component type
   Aave_2051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: ABM32634
UniProt: A1TNU6
LinkDB All DBs
Position
2244087..2244857
Genome map
AA seq 256 aa AA seqDB search
MPLLDLHGKRGLVVGIANDQSIAWGCARAFRDAGAELAVTWLNDKARAYVEPLARQVDAP
ITLPLDVEQPGQMEAVFGAVAREWGRLDFVLHSIAFAPRSDLSGRVTDSSREGFARAMDI
SCHSFLRMARLAEPLMPQGGSLMTMSYVGAAEVIPGYGVMGPVKAALESGTRYLAAELGP
KGIRVNAVSPGPLATRAASGIPDFDTLMADAVRRAPLRRLVELEEIGALCAFLASDGARA
ITGNTLYVDAGHHILG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcctttactggacctgcacggcaagcgcggattggtcgtcggcatcgccaatgaccag
agcatcgcctggggctgtgcccgcgccttccgcgatgcgggggcggaactggcggtcacc
tggctcaacgacaaggcccgggcgtatgtggagccgctggcgcggcaggtggatgcgccg
atcacgctgccgctggacgtggagcagcccggccagatggaggcggtattcggtgccgtc
gcccgcgaatgggggcgcctggatttcgtgctgcattccatcgccttcgcgccgcgcagc
gatctttccgggcgcgtgaccgacagctcgcgcgagggtttcgcgcgggcgatggatatt
tcctgccattccttcctgcgcatggcccggctggccgagccgctgatgccgcagggcggc
agcctgatgacgatgagctacgtcggcgcggccgaggtgattcccggctatggcgtgatg
gggccggtgaaggcagcgctggaatccggcacgcgctacctggccgcggaactggggccg
aaggggatccgcgtcaacgcggtctcccccgggccgctggccacgcgggcggcctccggc
attcccgacttcgacacgctcatggcggatgccgtgcggcgggcaccgctgcgccgcctg
gtggagctggaggagatcggcgcgctgtgcgccttcctggccagcgacggtgcgcgggcc
atcaccggcaatacgctgtacgtggatgcgggccaccatatcctgggctga

DBGET integrated database retrieval system