KEGG   Acidovorax citrulli: Aave_2573Help
Entry
Aave_2573         CDS       T00451                                 

Definition
(GenBank) transcriptional regulator, LysR family
Organism
aav  Acidovorax citrulli
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 MarR_2 HTH_28 HTH_AsnC-type HTH_24 MarR
Motif
Other DBs
NCBI-ProteinID: ABM33145
UniProt: A1TQA7
LinkDB All DBs
Position
complement(2823031..2823942)
Genome map
AA seq 303 aa AA seqDB search
MQRHFEDLKLGGIELFCTTAEQQSFTAAARAMGLTPAAVSRSISRLEARLGVQLLVRTTR
QVRLTEAGQAYFERCRQAITQLIDAEREVTGQQQAPTGLVRISLPTPYGHYRVLPLLPAF
RTRYPGITLDVQLTNRNIDFAAEGFDLAVRGRTLPDSGLVARKLEDAELVVVATPAYLSR
HGRPTTLESLQEHDCIQFLLPSTGQPTPWLFRQKGVDVEHLTRGGICCAEDILGTVTLAR
NGAGLLQTYRFIVEEDLARRTLVPVLSEWDGASRPFSLLYPAQRHMPLRVRVTIEFLLAS
LAA
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgacactttgaagacctgaagctgggcggcatcgaactgttctgcacgacggcg
gagcagcagagcttcacggcagcggcgagggccatgggattgacgcctgccgccgtcagc
cgctccatcagccgcctcgaggcgagactgggcgtccagttgctcgtgcgcacgaccagg
caggtgcgcctgaccgaagccgggcaggcgtatttcgagcgttgccgccaggccatcacg
caattgatcgatgcggaaagggaggtcacgggccaacagcaggcaccgacaggcctggtg
cgcatcagcttgcctaccccctatggacactatcgcgtgctgcccctgctaccggccttc
cggaccaggtatccgggcatcacgctggatgtccagctcaccaatcgcaacatcgacttc
gcagcggaggggttcgacctcgccgtgcgtggccgcaccctgccggactcggggctggtc
gcccgcaagctggaggacgccgagctggtcgtcgtggctacgccggcgtacctgagccgg
cacgggcgccccacgacgctggaatcgctgcaggagcacgattgcatccagttcctgctg
cccagtaccggccagcccacgccgtggctgtttcggcagaaaggcgtggatgtcgaacac
ctgaccaggggcggcatctgctgcgcggaggacatcctcggaaccgtgaccctggcccgg
aacggcgcgggcctgttgcagacctaccggttcatcgtcgaggaggacctggctcggcgc
acactggtgcctgtgctgtccgagtgggacggagcttcgcggccgttctcgctgctgtat
ccggcgcaacggcacatgccgttgcgggtacgggtgacgatcgaattcttgctggccagt
ctggcagcatga

DBGET integrated database retrieval system