KEGG   Acidovorax citrulli: Aave_2866Help
Entry
Aave_2866         CDS       T00451                                 

Definition
(GenBank) extracellular solute-binding protein, family 1
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
aav  Acidovorax citrulli
Pathway
aav02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:aav00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Aave_2866
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aav02000]
    Aave_2866
Transporters [BR:aav02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter
    Aave_2866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_8 SBP_bac_1 SBP_bac_6 SBP_bac_11
Motif
Other DBs
NCBI-ProteinID: ABM33434
UniProt: A1TR46
LinkDB All DBs
Position
3157083..3158138
Genome map
AA seq 351 aa AA seqDB search
MRIRFLNLLLVSAGMLAAAGPASAQDQVVNLYSARHYATDEALYTGFTKATGIKINRVDA
DDAGIMARLKAEGSASPADVILLVDAARLYRGEMDGLFLPIKSKVLEDAIPANLRARPAA
DGGIPWFGLSTRARVIVYNKAKVNKDDVDTYEELGDPKNKGKICIRSGSHPYNLSLFGAV
TEHLGEQKAEAWLKGVVANLARPPKGGDTDQIRAVASGECEIAVTNSYYLARIMRSDKPE
DKDVASKVAVVFPNQQSWGTHMNIAGGAVARYSKNQANAVKFLEYLASPTAQNYFANGNN
EWPAARGVVSENPALREMTGGQPFKSETIPISAVGEHMPKVQQMLDRVGFK
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatccgcttcctgaacctgctcctcgtgtccgccggcatgctggccgctgcaggc
cctgcatccgcacaggaccaggtcgtgaacctgtactctgcgcgccactacgccaccgac
gaggcgctctacacggggttcacgaaggccaccggcatcaagatcaaccgcgtggacgcg
gacgacgccggcatcatggcgcgcctcaaggccgagggctccgcctcccccgccgacgtg
atcctgctggtggatgcagcgcgcctctaccgcggcgaaatggacggcctgttcctgccc
atcaagtcgaaggtgctcgaagacgccatccctgccaacctgcgcgcccgcccagcggcg
gacggcggcattccgtggttcggcctctccacgcgtgcccgggtcatcgtctacaacaag
gccaaggtgaacaaggacgacgtcgacacctacgaggaactcggcgacccgaagaacaag
ggcaagatatgcatccgctcgggctcgcatccctacaacctgagcctgttcggcgcggtg
accgagcacctgggcgagcagaaggccgaagcctggctcaagggcgtggtggccaacctc
gcgcggcctccgaagggcggcgacaccgaccagatccgcgccgtggcgtccggcgaatgc
gagatcgcggtcaccaacagctactacctggcccgcatcatgcggtccgacaagccggag
gacaaggacgtggccagcaaggtggccgtggtgttcccgaaccagcaatcctggggcacg
cacatgaacatcgcaggtggcgcggtggcgcgttattcgaagaaccaggccaacgcggtc
aaattcctcgagtacctcgcgagccccaccgcgcagaactacttcgcgaacggcaacaac
gagtggccggccgccaggggcgtggtgtccgagaaccccgcgctgcgcgaaatgacggga
ggccagcccttcaagagcgagacgatcccgatcagcgcggtgggcgagcacatgcccaag
gtgcagcagatgctggaccgcgtgggcttcaagtaa

DBGET integrated database retrieval system