KEGG   Alteromonas addita: AVL56_01290Help
Entry
AVL56_01290       CDS       T04403                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
aaw  Alteromonas addita
Pathway
aaw00564  Glycerophospholipid metabolism
aaw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aaw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AVL56_01290 (glpD)
Enzymes [BR:aaw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AVL56_01290 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 Pyr_redox_2 FAD_binding_3 NAD_binding_8 TMEM240 GIDA DUF3090
Motif
Other DBs
NCBI-ProteinID: AMJ96386
LinkDB All DBs
Position
312717..314243
Genome map
AA seq 508 aa AA seqDB search
MNQNTNSTQTVDVLVVGGGVNGAGVALDAAGRGLSVALCEKGDLAGATSSSSSKLIHGGL
RYLEHYEFRLVKEALAEREVLLEKAPHIMWPLRFRLPHQKHLRPAWMIRIGLFLYDSLAK
RNVLPRSKKMSTSPTGPLVNDITTCFEYSDGWVDDARLVVLNALAAQDQGASIYTRTECI
SAEKQDKLWKVTLKDALGKTFTINAKAVVNAAGPWAVSFLDRLADTKNPNAMRMVKGSHF
IVPKLYDTEEAYILQNKDGRIVFVIPYEDDFSLVGTTDENYVGEPSQAAISEDETEYLVE
VVNTYFKTKIDESDIVHSYSGVRPLLEEKNASAQELTRDYKVELSGTESSPILLNIFGGK
ITTYRKLAEHAVDKLTSLFPKAGKAWTKDVPLPGGAFTNKEDLIKQLQHDYPWLSESLGV
RYARQYGMLCIKFLEGKNGLDSMGENFGADMYKAEVDYLIDHEWAMSLEDVIWRRTKHGL
RLNQSEQANLESYITSRVSKSVDMQQSA
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagaatacaaatagtacacaaaccgttgacgtattagtggttggcggcggtgta
aatggtgccggagtagcattagatgcggccggtcgcggactttcggtagcactatgtgaa
aaaggcgatcttgcaggtgcaacgtcttcgtctagcagcaagttaattcatggtggttta
cgttatttagagcattatgagttccgccttgtaaaagaagcactcgccgagcgtgaagta
ctattagaaaaagccccacatattatgtggcctttacgttttcgtttacctcatcaaaag
catcttcgtcctgcatggatgattcgtattggtttgttcttgtacgattcactagccaaa
cgcaatgtattaccgcgttcaaagaaaatgtctacgtcacctacaggcccgttggttaac
gatattacaacctgttttgaatactcagatggttgggtagatgatgctcgtttagtggta
ttaaatgcactagcggcgcaagaccaaggtgctagcatctatacacgtactgaatgtatt
agtgctgaaaaacaagataagttatggaaagtcactttaaaagatgcattagggaaaacg
tttacaattaatgctaaggctgttgttaatgcagctggcccatgggctgtttcattccta
gatagacttgccgacaccaaaaatcctaacgcaatgcgtatggtgaagggcagtcatttc
attgtgcctaaactttacgacacagaagaagcttatattcttcaaaataaagatggccgt
attgtttttgttattccttacgaagatgatttttcactcgttggtactaccgatgagaac
tatgttggtgagccatcgcaagccgctatttctgaagatgaaactgaatatttggtcgaa
gtggtaaatacgtactttaaaacgaaaattgatgaaagcgatattgttcatagctacagt
ggcgtgcgcccattgcttgaagagaaaaatgcgtctgctcaagagctaactcgcgattat
aaagtggaactaagcggaactgagtcttcgccaatattgcttaatattttcggtggtaaa
attacgacctatagaaaacttgccgagcatgcagtagataagctaactagtttgtttcca
aaggcaggaaaagcctggacgaaagatgtaccacttccaggtggcgcgttcactaataaa
gaagatttgattaaacagcttcaacacgactatccatggttatctgagtcgttaggggtt
cgctatgcgcgccaatacggcatgttatgtattaagttccttgaaggcaaaaacggactc
gatagcatgggtgagaactttggtgccgacatgtacaaagctgaagttgactaccttatt
gatcacgaatgggcgatgtcccttgaagacgtaatttggcgccgtactaaacatggttta
cgtttaaaccaaagcgagcaagccaacctagaaagctatataacgagccgcgtttcaaaa
agtgtcgatatgcagcaatctgcgtag

DBGET integrated database retrieval system