KEGG   Alteromonas addita: AVL56_06825Help
Entry
AVL56_06825       CDS       T04403                                 

Definition
(GenBank) peptidyl-dipeptidase
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
aaw  Alteromonas addita
Brite
Enzymes [BR:aaw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     AVL56_06825
Peptidases [BR:aaw01002]
 Metallo Peptidases
  Family M2
   AVL56_06825
Exosome [BR:aaw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AVL56_06825
CD molecules [BR:aaw04090]
 Proteins
  AVL56_06825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2 Reprolysin_5
Motif
Other DBs
NCBI-ProteinID: AMJ94053
LinkDB All DBs
Position
1583586..1585409
Genome map
AA seq 607 aa AA seqDB search
MFSTKRTIVAALVSITLIGCGETTSKTETTPAASTAQDAQEFLINAQNDISKMQVPAAHA
EWSYATNINFDTAAVSAYFNEVLSTKVAVLAKEAAKFNDVEVDEDTRRQLNLLKNGLTMP
PPSDPAKAEQLAKIGSELSAMYGSGQYCMEDGTCKSLVEMSSEMATIRDADTLLEYWKGW
REVSVPMKPLYEQQVNLANEGAAELGFQNVSELWRGKYDMPADDFPKELDRLWGQVAPFY
ESLHCHVRAKLGEHYGEELVPQDQPIPAHLLGNMWAQTWGNVYDIVKPEQEMSVPDVTSS
LEAQGYDEIKMVKQAESFFSSLGFAPLPDTFWERSMFQKPEGRDAQCHASAWDLDDKDDL
RIKMCIQKTGEEFNVIHHELGHNYYQRAYKDQPLLYRGSANDGFHEAIGDTIALSITPKY
LKEIGLIDEIPDASNDIGMLMQVALDKIAFIPFGLMVDQWRWKVMAGEVSPEQYNTLWWE
LREKYQGVKAPIDRPADAFDPGAKYHVPANVPYTRYFLAHILQFQFHKALCDIAGDEGPL
NRCSIYNSEEAGTALNAMLEMGVSEPWQNALETLTGSPEMDASTIADYFAPLKTWLDEQN
ATRQCGW
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgttttcaactaaacgcactatcgtcgcagcactagttagcattacgctaataggttgc
ggtgaaaccactagcaaaactgaaacaacacctgcggcatctaccgcgcaagatgcgcaa
gaatttcttattaatgcgcaaaacgatattagtaaaatgcaggtaccagccgctcatgcc
gagtggagttacgctactaacatcaattttgataccgccgcagtaagtgcctatttcaat
gaagtactgtccaccaaagtagctgtgttagccaaagaagcggctaaatttaacgatgtt
gaagttgatgaagatacccgtcgtcaacttaacctgcttaaaaacgggctgaccatgcca
cctccttcagatccggcgaaagcagaacaacttgctaaaattggttctgagctaagtgca
atgtatggttccggccagtactgcatggaagatggcacctgtaaaagcttggtagaaatg
agcagtgaaatggcgactattcgcgatgccgacaccttactagagtactggaaaggttgg
cgcgaagtgtctgtgcctatgaagccgctgtatgaacaacaggtaaatttggctaacgaa
ggtgctgctgaattaggctttcaaaatgtgagcgaactatggcgcggtaaatacgatatg
ccagccgacgacttcccgaaagaacttgataggctgtggggacaagttgcgcctttctac
gaatcgctgcactgccacgttcgtgctaagttaggtgagcattatggtgaagaattggtt
cctcaagaccaaccaattccagcgcacttgttaggcaatatgtgggcgcaaacctggggc
aacgtttacgatatcgtgaagcctgaacaagaaatgtcagtacccgatgttacttcatcg
ctcgaggctcagggctatgatgaaataaaaatggtaaaacaggctgaatctttcttttcg
tcattgggctttgcgccgctgcctgatacgttttgggagcgctctatgttccaaaaacct
gaaggccgcgacgcacagtgtcacgcttcagcatgggacttagatgacaaagacgattta
cgtattaagatgtgtattcaaaaaacgggggaagagtttaacgttattcatcatgaactg
ggtcacaactattaccaacgtgcttataaagaccagcctttgctgtatcgcggttcagct
aacgatggcttccatgaagcgattggcgacaccattgccttgtcgattacccctaagtac
ttaaaagaaattggtttgattgacgagatcccagatgcgtctaacgacataggcatgcta
atgcaggtggcgctagataaaattgcctttattccatttggtttgatggtggatcaatgg
cgctggaaagtgatggccggtgaagtatcgcctgagcaatacaatacactttggtgggaa
ttaagagaaaagtaccaaggtgtaaaggcaccgatagacaggcctgcagatgcgtttgac
ccaggcgctaaatatcatgttccggctaacgtgccctacactcgctacttcttagcgcat
attttgcaattccagttccataaagccttgtgtgacattgccggtgacgaaggcccactt
aatcgctgttctatttataacagtgaggaagcgggtaccgcgctaaacgccatgcttgaa
atgggcgtaagtgaaccatggcaaaatgcgttagaaactcttactggctcacctgaaatg
gatgcaagtaccattgctgactactttgcaccgctaaaaacgtggttagatgagcaaaat
gcgacgcgtcagtgtggatggtaa

DBGET integrated database retrieval system