KEGG   Alteromonas addita: AVL56_15495Help
Entry
AVL56_15495       CDS       T04403                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
aaw  Alteromonas addita
Pathway
aaw00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:aaw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AVL56_15495
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aaw02000]
    AVL56_15495
Enzymes [BR:aaw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AVL56_15495
Transporters [BR:aaw02000]
 Other Transporters
  Pores ion channels [TC:1]
   AVL56_15495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AMJ95569
LinkDB All DBs
Position
complement(3612990..3613628)
Genome map
AA seq 212 aa AA seqDB search
MYTLYGYPKTRSVRVAWALEEIGLPYEYKVVNLKAGEHLNSAFKTLNPATKIPVLVTEEG
ALSESAAIVTFLAEKHAMEEFIPAPGTFARGLYEQMMVFAVTELEQPLWSKAKHTFALPE
QHRIPQMQDTAAWEFDRALTAFSLLLNDKEYVCGSLFTMADIVTAQVLSWAKGSDLDLKF
DNVKSYAERVLSRPAYEKAWRNEMAHLSKTDA
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgtatacactttatggatacccgaaaactcgctcggtaagggtggcatgggctttagaa
gaaattggcttgccttacgagtacaaggtggtgaatttaaaagccggtgaacacttaaac
tcagcttttaaaacacttaacccggccactaaaattcctgtattagtcactgaagaaggt
gcgctttctgagtcggctgctattgtcactttcttagctgaaaagcatgcaatggaagag
tttatacctgcacccggtactttcgctcgcgggctgtatgagcaaatgatggtatttgct
gttactgagttagaacagccgctttggagtaaagctaaacatacctttgctttacctgag
cagcaccgtattccccaaatgcaagatacagcggcgtgggaattcgaccgagcattaacg
gctttctcgctacttctcaacgacaaagagtatgtctgcggaagcttattcacaatggca
gacattgtgacagcccaagtattgtcatgggctaaaggtagcgaccttgaccttaagttc
gacaatgtgaaatcgtacgctgaacgggtgctatctcgccctgcttatgaaaaagcatgg
cgcaacgagatggcacatttgtctaagactgatgcttaa

DBGET integrated database retrieval system