KEGG   Altererythrobacter atlanticus: WYH_00229Help
Entry
WYH_00229         CDS       T03925                                 

Definition
(GenBank) Angiotensin-converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
aay  Altererythrobacter atlanticus
Brite
Enzymes [BR:aay01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     WYH_00229
Peptidases [BR:aay01002]
 Metallo Peptidases
  Family M2
   WYH_00229
Exosome [BR:aay04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   WYH_00229
CD molecules [BR:aay04090]
 Proteins
  WYH_00229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: AKH41293
UniProt: A0A0F7KL56
LinkDB All DBs
Position
215893..217740
Genome map
AA seq 615 aa AA seqDB search
MKILASVALFALAAGISAPTLAQGETSTSASEESYPMTPAGAAQFVAAVERDLFDYSVDA
SRVYWVNATYITPDTDALAAKVGAEGTEKSVKYALEAAKFARIDGLDPDVRRKLDILRTG
IVLPAPTTPGAADELNTIATALNSQYGKGKGTLNGEPIAGSDIEAEMGNLDHTPQEYAEM
WASWHDNVGAPMKDDYARMVEIANEGAKELGFADVGAMWRANYDMDPTEFTAMTERLWQE
TRPLYLALHTYVRSKLNQKYGDAVQPATGPIRADLLGNMWAQEWGNIYPLVAPEGSGDLG
YDIGDLLEEKGKGPLDMVKIGEGFYSSLGFKPLPETFWERSQFTKPADREVVCHASAWDV
DNKDDIRIKMCIKVNADDFVTIHHELGHNYYQRAYNEQPYLYLNGANDGFHEAIGDFIAL
SITPEYLVQIGLLDRADVPGPEKDTGLLLRQAMDKVAFLPFGLLIDKWRWGVFDGSIPPQ
EYNQAWVGLKQDYQGIVPPVERPADAFDPGGKYHIPGNTPYMRYFLARILQFQFFKAACD
QAGWEGPLHRCSFYGNEEVGQKLNDMLEMGASKPWPEALEAFTGTREISAKPMLEYFAPL
KAWLDEQNKGKPQGW
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcctggcatcggttgccctgttcgccctggcggcaggcatttccgcccctaca
ttggcgcaaggcgaaacgagcacctccgcaagcgaggaaagctatcccatgacaccggca
ggcgcggcgcaattcgtcgctgccgtggagcgggatctgttcgattattccgtggatgcc
agccgcgtctattgggtgaacgccacctatatcacgccggatacggatgcactggcggcg
aaggtcggtgcagagggcacggaaaagagcgtcaaatatgcgcttgaagccgcgaaattc
gcgcgcatcgacgggctcgatcccgacgtccggcgcaagctggacattctgcgcaccggc
atcgtcctccccgcgccgaccacgcccggcgccgcggacgagctgaacacgatcgcgacc
gcgctcaattcccaatatggcaagggcaagggcacgctgaatggcgaaccgattgccgga
tccgatatcgaggcggagatgggcaatctggatcacactccgcaggaatatgcggaaatg
tgggcaagctggcatgacaatgtgggcgcgccgatgaaggacgattacgcccgcatggtg
gaaatcgccaatgaaggcgcgaaggagcttggcttcgccgatgtcggcgccatgtggcgc
gccaattacgatatggacccgaccgaatttaccgccatgacagagcggttgtggcaggaa
acgaggccgctttatctggcgctgcacacttatgtccgcagcaagctgaaccagaaatat
ggcgatgcggtgcagcctgccaccggcccgatccgcgccgacctgctcggcaatatgtgg
gcgcaggaatggggcaatatctatccgctcgtcgcgcccgaaggttcgggcgatctcggc
tatgacattggggacctgctggaagagaagggcaagggcccgctcgacatggtgaagatt
ggcgaggggttctattcctcgctcggcttcaagcccttgccggagactttctgggaacgg
agccagttcaccaagccggcggatcgtgaagtcgtctgccacgccagcgcctgggacgtg
gataacaaggacgatatccgcatcaagatgtgcatcaaggtgaatgcggatgatttcgtc
accatccaccacgagctgggccacaattattaccagcgcgcctataacgaacagccctat
ctctatctgaacggcgcgaatgacggcttccacgaagccattggcgatttcatcgccctg
tcgatcacaccggaatatctggtccagatcggcctgctcgaccgcgccgatgtgccgggc
ccggaaaaggataccggcctgttgctgcgccaggcgatggacaaggtggccttcctgcct
ttcggcctgctgatcgataaatggcgctggggcgtttttgacggttcgatcccgccgcag
gaatacaaccaggcatgggtcgggctgaagcaggattatcagggcatcgtgccgccggtc
gaacggccggccgatgccttcgatccgggcgggaaataccatatcccgggtaacacgccc
tatatgcgctatttcctggcccgcatcctgcagttccagttcttcaaggccgcttgcgat
caggcgggatgggaaggcccgcttcaccgctgcagcttctatggcaatgaggaagtcggg
cagaagctgaacgacatgctggaaatgggcgccagcaagccctggccggaagcgctggaa
gccttcaccggcacgcgcgagatcagtgccaagccgatgctcgaatattttgcgccgctg
aaggcatggctggacgaacagaacaagggcaagccgcaaggctggtaa

DBGET integrated database retrieval system