KEGG   Altererythrobacter atlanticus: WYH_01341Help
Entry
WYH_01341         CDS       T03925                                 

Gene name
ddl_2
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
aay  Altererythrobacter atlanticus
Pathway
aay00473  D-Alanine metabolism
aay00550  Peptidoglycan biosynthesis
aay01100  Metabolic pathways
aay01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:aay00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    WYH_01341 (ddl_2)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    WYH_01341 (ddl_2)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    WYH_01341 (ddl_2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aay01011]
    WYH_01341 (ddl_2)
Enzymes [BR:aay01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     WYH_01341 (ddl_2)
Peptidoglycan biosynthesis and degradation proteins [BR:aay01011]
 Precursor biosynthesis
  Amino acid ligase
   WYH_01341 (ddl_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AKH42382
UniProt: A0A0F7KT40
LinkDB All DBs
Position
complement(1386778..1387749)
Genome map
AA seq 323 aa AA seqDB search
MSVKLPKLHVAVLMGGWANEREVSLMSGKGVADALEIKGHRVTRIDMGRDIAARLAEAAP
DVVFNALHGVPGEDGTVQGMMDLMGIPYTHSGLATSVIAIDKELTKHALVPHGVPMPGGR
IVRSEDLYEGDPLARPYVLKPVNEGSSVGVAIVTEESNYGNPIRRDARGPWQEFSSLLAE
PYIRGRELTTAVLGDRALMVTELVPKSGFYDFDAKYTDGMTEHVCPAKIPPEIEKLCLDY
ALKAHRLLGCRGTSRSDFRWDDERGEDGLFLLETNTQPGMTPLSLVPEQARHCGIDYADL
VEIIIADALTFFGKLPPESGKAG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgaaactccccaaactgcatgttgctgtcctgatgggcggctgggccaatgaa
cgcgaagtctcgctgatgagcgggaagggcgtggccgatgcgctggaaatcaaggggcat
cgcgttacccggatcgacatgggccgcgatattgcagcccgcctggccgaagccgcgccg
gacgtggtgttcaacgcgctgcatggcgttccgggcgaagacgggacggtgcagggcatg
atggacctgatgggcattccctatacccattccggcctcgccacttccgtgatcgcgatc
gacaaggaactgaccaagcacgcgctggtgccgcatggcgtgcccatgccgggcggacgg
atcgtgcgtagcgaggatttgtacgagggcgacccgctggcgcgcccctatgtgctcaag
cccgtgaacgaaggatcgtccgtcggcgtcgccatcgtcacggaagaaagcaattacggc
aatccaatccgccgcgatgcgcgcggaccgtggcaggaattttccagcctgctggccgaa
ccctatattcgcgggcgggaactgaccacggccgtgctgggcgaccgggcgctgatggtg
acggagctggtgccgaaaagcggcttctacgatttcgacgccaaatataccgatggcatg
accgaacatgtctgcccggcgaagatcccgccggagatcgagaaattgtgcctcgattat
gcgctgaaggcgcaccgcctgctgggctgccgcggcaccagccggtccgatttccgctgg
gatgatgaacggggcgaagacgggctgttcctgctggaaaccaatacccagccggggatg
acgccgctcagcctcgtgcccgaacaggcgcgccattgcggcatcgattatgccgatctg
gtggagatcatcattgccgatgcgctgactttctttggcaaattgccccctgaatccggg
aaggccggctga

DBGET integrated database retrieval system