KEGG   Altererythrobacter atlanticus: WYH_01633Help
Entry
WYH_01633         CDS       T03925                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
aay  Altererythrobacter atlanticus
Brite
KEGG Orthology (KO) [BR:aay00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    WYH_01633 (ahpF)
Enzymes [BR:aay01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     WYH_01633 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored HI0933_like K_oxygenase Spermine_synth AlaDh_PNT_C DAO NAD_binding_7 FMO-like FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AKH42669
UniProt: A0A0F7KSV0
LinkDB All DBs
Position
1690115..1691704
Genome map
AA seq 529 aa AA seqDB search
MLDANMTQQLQQFLGNLREPIELVASLGDDDKSAQTRELLEEIAALNDKVTASFDGTNER
KPSFIIRRASDAEKWVRFAGLPMGHEFTSLVLALLWAGGHPPKVEQDVLDQIAALEGDYN
FEMYFSLSCHNCPDVVQALTLMALNNPRITATLIEGGAFQDEVEKRNVLAVPATFLNGEM
FASGKMSVEEVLAKLDGNAGARAAAKLADKEPFEVLVIGGGPAGAAASVYTARKGFSTGI
AAERFGGQVLDTMGIENFISVPYTEGPKLAAQLEAHVGEYDIDVMNLQTAKQLIPARQPG
GMHEVVFENGASLKARSIILSTGARWRNLGVPGEFEYRNRGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLANIVGHVTLVEFDSKLRADQVLQDKLRSLANVDILVSAQTTEITGD
GERVNGLVYKNRESGEEKTVELEGVFVQIGLVPNTEWLKESGLELSKFGEIMIDEKAATN
LPGIFAAGDCTTVPYKQIIIAMGEGSKAALSAFDYLIRTQPADEVAEAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaatatgacgcaacagctccagcaatttctcggcaacctgcgcgagccg
atcgagctcgtcgcctctctcggcgacgatgacaaatcggcccagacccgcgaattgctg
gaagaaattgctgccctgaacgacaaggtgaccgccagtttcgacggcaccaacgaacgc
aagcccagcttcatcatccgccgcgcaagcgatgcggaaaagtgggtccgcttcgccggc
ctgccgatgggccatgaattcaccagcctcgtgctggccctgctctgggccggtggccac
ccgcccaaggtggaacaggatgtgctggaccagatcgccgcacttgaaggcgattacaat
ttcgagatgtatttctccctgtcctgccacaattgcccggacgtggtgcaggccctgacg
ctgatggcgctgaacaatccgcgcatcacggccacgctgatcgaaggcggtgccttccag
gacgaggtggagaagcgcaatgtcctcgccgtgccggcaaccttcctcaacggggaaatg
ttcgccagcggcaagatgagcgtggaagaagtgctggccaaactggatggcaatgccggc
gcccgcgcggcggccaagctggccgacaaggaaccgtttgaagtgctggtcatcggcggc
ggccccgccggtgcggcagcctccgtctatacggcgcgcaagggcttcagcacgggcatc
gcggcagaacgcttcggcgggcaggtgctggacacgatggggatcgagaacttcatttcc
gtcccctataccgaaggccccaagctggccgcccagctggaagcgcatgtcggtgaatat
gacatcgacgtgatgaatttgcagacggcgaaacagctcattccggccaggcagcccggc
gggatgcacgaggtggtgttcgaaaacggcgcttcgctgaaggcccggtccatcatcctg
tccaccggcgcccgctggcggaatctgggcgtgccgggcgaattcgaatatcgcaatcgc
ggcgtggcctattgcccgcactgcgacggcccgctgttcaagggcaagcgagtggcggtt
atcggcggcggcaatagcggcgtcgaagcggcgatcgacctggccaatatcgtgggccat
gtcacgctggtcgaattcgacagcaagctgcgcgccgaccaggtgctgcaggacaagctc
cgcagcctggccaatgtcgacatcctcgtctccgcacagacgacggagatcaccggcgat
ggcgagcgggttaacggcctggtctacaagaaccgcgaaagcggggaagaaaagacggtc
gagctggaaggcgtgttcgtccagatcggcctggtgcccaacaccgaatggctgaaggaa
tcgggccttgaactgtcgaaattcggcgagatcatgatcgacgaaaaggcggcgacgaac
cttcccggtatcttcgcagcgggcgattgcaccaccgtgccttacaagcagatcatcatc
gccatgggcgaaggatcgaaagcagcattgagcgcattcgattatctgatccgcacccaa
ccggcggacgaggtggccgaagcggcctga

DBGET integrated database retrieval system