KEGG   Altererythrobacter atlanticus: WYH_03205Help
Entry
WYH_03205         CDS       T03925                                 

Gene name
accC_2
Definition
(GenBank) Biotin carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
aay  Altererythrobacter atlanticus
Pathway
aay00061  Fatty acid biosynthesis
aay00620  Pyruvate metabolism
aay00640  Propanoate metabolism
aay01100  Metabolic pathways
aay01110  Biosynthesis of secondary metabolites
aay01120  Microbial metabolism in diverse environments
aay01130  Biosynthesis of antibiotics
aay01200  Carbon metabolism
aay01212  Fatty acid metabolism
Module
aay_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:aay00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    WYH_03205 (accC_2)
   00640 Propanoate metabolism
    WYH_03205 (accC_2)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    WYH_03205 (accC_2)
Enzymes [BR:aay01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     WYH_03205 (accC_2)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     WYH_03205 (accC_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_C Biotin_carb_N Dala_Dala_lig_C ATP-grasp ATP-grasp_3 RimK ATPgrasp_Ter LAL_C2
Motif
Other DBs
NCBI-ProteinID: AKH44224
UniProt: A0A0F7KX21
LinkDB All DBs
Position
complement(3337989..3339341)
Genome map
AA seq 450 aa AA seqDB search
MAIRRILIANRGEIAVRIIRTCEALGIETVLCVSEADRNSLGAQMATRAVCIGPASPARS
YLSMETVMQAAIGYHCDAIHPGYGFLSERAEMAKMCEDEAVIFIGPTASQIEAVGDKLRA
RSEAIAADVPVVPGGPVETPEDARKLAEEIGAPLLIKAVGGGGGRGMKLVENLKDLNSTM
DMASAEAGAAFGDARVYIERYVEHGRHIEVQLLGDGAGRVIHLGERDCSVQRRYQKLVEE
TPAPHLPPATREKLLDAAVRFAERLHYRGAGTVEFLYDVARDEFYFLEMNARIQVEHPVT
EMVSGVDLIAQQIAIAADEGLRVTQEEIGLNGAAIECRINAEDPANGFMPSPGTVTSVQW
PEGEGIRVDTHIVEGASIPPFYDSMIAKIIAHGPDRATALARLRGALERTRIDGIATNLA
FQQEVLAEPEFAAGGVDTGFLARKLQKEPA
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggccatccggcgcatattgatcgccaatcgcggcgaaatcgccgttcgcatcatccgc
acatgcgaggcgctgggcatcgaaaccgtgctgtgcgtgtcggaggcggatcgcaattcg
ctgggcgcgcaaatggccacgcgggccgtctgtatcggccccgccagcccggccagaagc
tatctgtccatggaaaccgtgatgcaggcagccatcggatatcactgcgatgcgatccat
cccggttatggattcctgtccgaacgtgccgaaatggcaaaaatgtgcgaagatgaagcg
gtaatcttcatcggccctacggcaagccagatagaagccgtgggcgacaagctgcgcgcc
cgcagcgaagccatcgccgccgatgttcccgtggtcccgggcgggccggtcgaaacaccg
gaagatgcgcgcaaactggccgaagaaatcggcgccccgctgctgatcaaggcggtcggc
ggtggcggcgggcgcggcatgaaactggtggagaatctgaaagacctgaactccacgatg
gacatggccagcgcggaagcgggcgccgcctttggcgatgcgcgcgtctatatcgaacgc
tatgtcgaacatggccgccatatcgaagtgcaattgctgggtgatggcgcaggccgcgtg
atccacctgggcgaacgcgattgttcggtccagcgccggtatcagaaactggtggaggaa
accccggctccgcatctgccgccagccacgcgggaaaagctgctggatgccgcggtccgc
tttgccgaaaggctgcattatcgcggcgcggggacggtcgaattcctctatgacgttgcg
cgggacgaattctatttccttgaaatgaatgcccgcatccaggtggaacatcccgtaacc
gaaatggtcagcggggtggacctgatcgcgcagcagatcgccatcgccgcggacgaaggg
ttgcgcgtcacgcaggaagagatcggcctgaacggcgcggcgatcgaatgccggatcaat
gccgaagatccggccaatggcttcatgccctcccccggcacggtaacttcggttcagtgg
ccggagggcgaaggcatccgggtggacacgcatatcgtggagggcgcgagcattccgccc
ttctacgattccatgatcgccaagatcatagcccacggcccggaccgggcgaccgccctg
gcccgcctgcgcggcgcgctggaacgcacgcggatagatgggatcgccaccaatctggcc
ttccagcaggaagtgctggccgaaccggaatttgcggcgggcggcgtggataccggcttc
ctggcgcggaagctgcagaaggagcctgcctga

DBGET integrated database retrieval system