KEGG   Aggregatibacter aphrophilus W10433: ADJ80_00165Help
Entry
ADJ80_00165       CDS       T04521                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
aaz  Aggregatibacter aphrophilus W10433
Pathway
aaz00550  Peptidoglycan biosynthesis
aaz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aaz00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ADJ80_00165
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:aaz01002]
    ADJ80_00165
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aaz01011]
    ADJ80_00165
Enzymes [BR:aaz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ADJ80_00165
Peptidases [BR:aaz01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   ADJ80_00165
Peptidoglycan biosynthesis and degradation proteins [BR:aaz01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   ADJ80_00165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 tRNA-synt_1_2 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AKU62291
UniProt: A0A3M6P289
LinkDB All DBs
Position
complement(34703..35890)
Genome map
AA seq 395 aa AA seqDB search
MFNKVVKNSKIALVATLFTMPFSTMAEDAQFNIAAPQINAQTYVLMDYNSGAVLASLNPD
QRQYPASLTKMMTSYVVGQALKQGKVHNTDMVTIGESAWGQNFPGSSKMFLNLNQQVSVA
DLNRGIIIVSGNDACVAMAEHVSGTVMNFVDTMNKYVEQFGLKNTRFTTVHGLDEEGQYS
SARDMAIIGAHIIRDLPDEYKIYAEKDFTFNKIKQPNRNGLLWDKTINVDGMKTGHTDKA
GYNLVASATNPNNMRLISVVMGVPTYKGREVESKKLLQWGFANFETFKTFEAGKSISEQR
VYYGDESNIQLGVLQDAFITIPKGKSSELKARYELDKKYLEAPLAKGQVVGKVVYQLDGK
DIASVNLQVMQEVKEGGIFGKIWDWLVLTIKSLFD
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtttaacaaagtcgtaaaaaacagcaaaattgcattagttgcaactctcttcaccatg
cctttcagcacgatggcagaggatgctcagtttaatattgccgcaccgcaaattaacgca
caaacctatgttttaatggattacaactccggtgccgtattggcttcattgaatccggat
cagcgccagtaccctgcgtccttaacgaaaatgatgaccagctatgtggtggggcaagcg
ttaaaacaaggcaaagttcataataccgacatggtcacaatcggggaaagtgcatgggga
caaaatttcccgggctcatctaaaatgttcctaaatttaaatcaacaggtttctgtggcg
gatttaaatcgtgggattattattgtttccggtaatgatgcctgtgttgctatggcagaa
catgtttccggcacggtaatgaattttgtggataccatgaacaaatatgtagaacagttt
ggtttgaaaaacacccgttttactactgtgcatggtttagatgaagaagggcaatattct
tctgcacgagacatggcaattattggtgcacatattattcgtgatttgccggatgaatat
aaaatttatgcagaaaaagattttacctttaacaaaattaaacaaccgaatcgcaatggc
ttgttatgggataaaaccattaatgttgatggcatgaaaaccggtcatacggacaaagcc
ggttataaccttgtagcttctgcaaccaatccgaataatatgcgtttgatttccgtagtc
atgggcgtgccgacttacaaaggtcgcgaagtggaaagcaaaaaattattacaatggggt
tttgctaattttgaaacctttaagacttttgaagcgggcaagtccatttctgagcaacgg
gtttattacggtgatgaaagcaacattcagttaggtgtattacaggatgctttcattact
attccgaaaggtaaaagtagtgagctgaaagcccgttatgaattagataaaaaatacctt
gaagcgcctttagcaaaaggtcaagttgtcggtaaagtcgtttaccaactcgacggcaaa
gatattgccagcgtaaacttgcaagtcatgcaagaagtgaaagaaggcggtattttcggc
aaaatttgggattggttagtacttaccatcaaaagcttatttgactag

DBGET integrated database retrieval system