KEGG   Aggregatibacter aphrophilus W10433: ADJ80_00180Help
Entry
ADJ80_00180       CDS       T04521                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
aaz  Aggregatibacter aphrophilus W10433
Pathway
aaz00550  Peptidoglycan biosynthesis
aaz01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:aaz00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ADJ80_00180
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ADJ80_00180
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aaz01011]
    ADJ80_00180
Enzymes [BR:aaz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ADJ80_00180
Peptidoglycan biosynthesis and degradation proteins [BR:aaz01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   ADJ80_00180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AKU62293
UniProt: A0A3M6P2D2
LinkDB All DBs
Position
complement(37961..39910)
Genome map
AA seq 649 aa AA seqDB search
MNLKKLLSQPQYDPIRDKKAERNLFARRALVSFIGVLVLSVVLILNLYDLQVVNYDSYQT
RSNGNRIKLLPLPPTRGLIYDRNGQLLAENLTFFGLYVVPEKVENLDRTFEELKVLVGLT
DTDIENFKKERRRSTRYTPIMLKPNLTEEQIARFAVNQYNFPSLDIRPYFKRHYLYGEPL
THILGYVSKINDRDVERLKKEEKFANYSGTHDLGKLGIERYYEDSLHGTTGFEEVEVNSR
GKVIRKLREQPAIAGKSIHLTIDLNLQLYVTELLAGHKGAVVVMDPKDNSILAMVSVPSY
DNNLFVDGISGEAYSRLLNDPNRPLYSRVTQGAYPPASTVKPFIAVSALQENVITPNMTI
YDPGYWSLPNSTKRFRDWRKGGHGMTNLNKAITESSDTYFYQTAYNLGIDRLSNWMKRFG
FGVPTGIDIQEETGANMPTREWKQKRYKKAWVQGDTISVGIGQGYWTATPLQLAKATSIL
VNNGKVNTPHLMKSVEGSVVEPYKDPLPYEDITEPKQYFWDEAKRGMYNVVNGAGGTGRK
AFIGTSYRVAGKSGTAQVFSLKENQSYNAGALKKELHDHAWFTAFAPYDNPQIVVSIILE
NAGGGSSNAAPIVRQIMDYYFKQNTPLPIEQSTEEPLIEPTTGEPNENE
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgaatctaaaaaaacttctgtcgcaaccgcaatacgatccgattcgtgataaaaaagcc
gagcgcaatttgtttgcccgtcgtgctttggtgtcatttatcggtgttttggtgttgtct
gtagtgttgattctgaatctatatgatttgcaggtggtgaattacgacagttatcaaacc
cgttctaacggcaaccgcattaaattgttgccattaccgccgacccgaggcttgatttac
gatcgcaacggacaattattggcagaaaatttgacctttttcggattatatgtggtgccg
gaaaaagtggaaaatttagaccgcacttttgaggaattaaaagtgttggtagggctgacc
gatacggatattgaaaattttaagaaagaacgccgtcgttcaacccgttatacgccgatt
atgttaaaaccgaatttaacggaagaacaaatcgcccgttttgcagtgaatcaatataat
ttcccaagtttagatattcgtccttattttaaacgccattatctttatggtgaaccgctg
acccacatcttaggttatgtgtcgaaaattaatgatcgtgatgtggaacgcttgaaaaaa
gaggaaaaattcgcgaattattccggtactcacgatttaggtaagcttgggattgagcgt
tattatgaagattctctgcacggcaccacaggctttgaagaggtggaagttaatagccgt
ggtaaagtgattcgtaagctacgcgaacagcctgccattgcggggaaaagtattcattta
acgattgatttaaatttacaactttatgttacggaactcttggctgggcataaaggagct
gtggtcgtgatggatccgaaagacaacagcattttagccatggtttccgtaccgagttat
gacaataatttatttgtggacggtatttccggtgaggcctatagtcgtttgttaaatgat
ccgaatcgaccgctttatagccgtgtgacacagggggcttatccgccggcatctacggtg
aaaccgtttattgcagtgtcggctttgcaggaaaatgtgattaccccgaacatgaccatt
tatgatccgggttattggagtctgccaaatagcaccaagcgtttccgtgactggcggaaa
ggtgggcatggtatgacaaatttaaataaagccattaccgaatcttccgatacctatttt
taccagaccgcttacaatttggggattgaccgtttgtccaattggatgaagcgttttggt
tttggtgtgccgaccggtattgatattcaagaagaaaccggcgccaacatgccgacccga
gaatggaaacaaaagcgctataaaaaagcttgggtacaaggtgatactatttccgtaggt
atcgggcaaggctattggacggcaacaccacttcagctagcgaaagccaccagtattcta
gtgaataacggcaaggtaaatacaccgcacttgatgaagagcgtggagggttctgtggtg
gaaccttataaagatccgttgccatatgaagatattaccgaaccgaagcaatatttctgg
gatgaagcaaaacgcggcatgtataacgtggtgaacggtgctggcggaacggggcgtaaa
gcttttatcggtacgtcttatcgtgtcgcgggaaaatccggtacggcgcaggtatttagt
ttgaaagagaaccaaagttataacgcaggcgctttaaaaaaagaattacacgatcatgct
tggtttactgcatttgccccttatgataacccgcaaattgtcgtatccataattttggag
aatgcaggtggaggttccagcaatgcggcgccgattgttagacaaattatggattattac
tttaaacaaaacacgccgttaccaatagaacaaagcacggaagaaccgttaatcgagccg
accacaggagagccaaatgaaaatgaatga

DBGET integrated database retrieval system