KEGG   Aggregatibacter aphrophilus W10433: ADJ80_06470Help
Entry
ADJ80_06470       CDS       T04521                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
aaz  Aggregatibacter aphrophilus W10433
Pathway
aaz00061  Fatty acid biosynthesis
aaz00780  Biotin metabolism
aaz01100  Metabolic pathways
aaz01130  Biosynthesis of antibiotics
aaz01212  Fatty acid metabolism
Module
aaz_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:aaz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ADJ80_06470
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ADJ80_06470
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    ADJ80_06470
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:aaz01004]
    ADJ80_06470
Enzymes [BR:aaz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     ADJ80_06470
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     ADJ80_06470
Lipid biosynthesis proteins [BR:aaz01004]
 Fatty acid synthase
  Component type
   ADJ80_06470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short DUF4570
Motif
Other DBs
NCBI-ProteinID: AKU63425
UniProt: A0A0K1N2X2
LinkDB All DBs
Position
complement(1359139..1359927)
Genome map
AA seq 262 aa AA seqDB search
MGFLTGKRILVTGLASNRSIAYGIAKAMKEQGAELAFTYLNEKLQPRVEEFAKEFGANIV
LPLDVATDESIQNCFAELSKHWDKFDGFVHAIAFAPGDQLDGDYVNAATREGYRIAHDIS
AYSFVAMAQAARPYLNPNAALLTLSYLGAERAIPNYNVMCLAKASLEAATRVMAADLGKD
GIRVNAISAGPIRTLAASGIKNFKKMLATFEKTAALRRTVTIEDVGNSAAFLCSDLASGI
TGEIVHVDAGFSITAMGELGEE
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggtttcttaacaggtaaacgtattttagtcacaggtctcgccagcaaccgttctatc
gcttacggtatcgctaaggccatgaaagaacaaggtgcagaattagccttcacttattta
aatgaaaaattacaaccgcgtgttgaagaatttgccaaagaatttggcgcaaacatcgtt
cttccgttagacgttgccaccgatgaaagcattcaaaactgcttcgcagaattaagcaaa
cactgggataaatttgatggttttgtacacgccatcgcattcgcaccgggcgatcaatta
gacggcgactatgtgaatgcggcaacccgtgaaggttatcgcattgcccacgacatcagc
gcatacagttttgtagcaatggcgcaagcagcacgtccatatttgaatcctaacgcggca
ttattaaccctttcttacttaggtgcagaacgtgccattccaaactataacgtgatgtgt
ttagccaaagcctctcttgaagcggcaacccgtgtgatggcagcagatttaggcaaagac
ggcattcgtgtgaacgccatttccgcaggcccgattcgtaccttagcggcttccggcatt
aaaaacttcaagaaaatgttggcaaccttcgagaaaaccgctgcattacgccgtaccgtg
accattgaagatgtgggcaactccgcggcgttcttatgctctgatttagcatccgggatc
accggtgaaatcgtccatgttgatgcaggcttcagcatcaccgccatgggcgagttaggc
gaagaataa

DBGET integrated database retrieval system