KEGG   Aggregatibacter aphrophilus W10433: ADJ80_07625Help
Entry
ADJ80_07625       CDS       T04521                                 

Definition
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
aaz  Aggregatibacter aphrophilus W10433
Pathway
aaz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aaz01100  Metabolic pathways
aaz01110  Biosynthesis of secondary metabolites
aaz01130  Biosynthesis of antibiotics
aaz01230  Biosynthesis of amino acids
aaz02024  Quorum sensing
Module
aaz_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:aaz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ADJ80_07625
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ADJ80_07625
Enzymes [BR:aaz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     ADJ80_07625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1 DAHP_snth_FXD
Motif
Other DBs
NCBI-ProteinID: AKU63617
LinkDB All DBs
Position
1620611..1621693
Genome map
AA seq 360 aa AA seqDB search
MKTKNDISIENDDTRIGKIEQVLPPIALLEKYPASNIAAKTVEQARKETHQIIHGGDDRL
LVVIGPCSIHDPKAALEYAQRIKLMREKYKDTLQIIMRVYFEKPRTTVGWKGLINDPHLN
NSYALNDGLRMARKLLSDINDLTVPTAGEFLDMITPQYLADFMSWGAIGARTTESQVHRE
LASGLSCAVGFKNATNGCVKIALDAIGAAEAPHHFLSVTKFGHSAIVSTKGNNDCHIILR
GGDNGPNYSEKDVNDVCEELAKAGYKSHVMVDFSHANSSKQFKKQLEVCKNVCGQIASGS
EKIFGVMIESHLVEGRQNLVEGQPLTYGQSITDSCIGWEDSETVLQQLSDAVAARRKLKG
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaagaacgatatttccattgaaaatgacgatacacgaattggcaaaatcgag
caggtgttaccgccgattgcgttgctggaaaaatatcctgcaagcaatattgcggcgaaa
accgtagaacaagcccgcaaagaaactcaccaaattattcatggtggagatgatcgcctg
cttgtcgtgattggtccttgttccatccatgatccgaaagccgcattggaatatgcgcaa
cgtattaaattaatgcgtgaaaaatataaagacaccttacaaattatcatgcgcgtttat
tttgaaaaaccgcgtactactgtgggttggaaaggcctcattaatgacccgcatttaaat
aattcttatgccttaaacgacggtttgcgtatggcgcgtaaattgctatcggacattaac
gatttaaccgtgccgacggcaggggagtttttggatatgattacgccgcaatatttagca
gatttcatgagttggggggccattggggctagaaccaccgaatctcaagttcaccgtgaa
ttggcttccggcttgtcttgtgcggtcggttttaaaaatgccaccaacggttgcgtaaaa
attgcgttagatgccatcggtgcggcagaagcgccacatcattttttatcggttaccaag
ttcggccactctgcaattgtgtccacgaaaggtaataatgactgccatattattttacgt
ggtggtgacaacggcccgaattacagcgaaaaagatgttaatgacgtatgcgaagaattg
gctaaagcaggctacaaatctcatgttatggttgatttcagccatgccaacagtagcaaa
caattcaaaaaacaattggaggtttgtaaaaacgtgtgcgggcaaattgcttccggttcc
gagaaaattttcggtgtaatgattgaaagtcacttggttgaagggcgtcaaaacttggtt
gaaggtcagccgttgacatacggacaaagcatcaccgacagctgcattggttgggaggac
agcgaaaccgtgttgcaacagctctctgatgctgttgcggcaagacgaaaattaaaaggt
taa

DBGET integrated database retrieval system